KEGG   Homo sapiens (human): 23151
Entry
23151             CDS       T01001                                 

Gene name
GRAMD4, DIP
Definition
(RefSeq) GRAM domain containing 4
  KO
K23554  GRAM domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23151 (GRAMD4)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    23151 (GRAMD4)
SSDB
Motif
Pfam: GRAM PRT_C DUF639
Other DBs
NCBI-GeneID: 23151
NCBI-ProteinID: NP_055939
OMIM: 613691
HGNC: 29113
Ensembl: ENSG00000075240
Vega: OTTHUMG00000150402
Pharos: Q6IC98(Tbio)
UniProt: Q6IC98
Position
22q13.31
AA seq 578 aa
MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTL
IMATGVQDFNRTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQR
RMELEQKVQEVLKARTEEQMAQQPPKGQAQASNGAERRSQGLSSRLQKWFYERFGEYVED
FRFQPEENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWYSVYTSAIAFTV
YMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVPEVSEPVEPPKEDLTVSEKFQ
LVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEITQKLYVALWAAFLASCFFPYRLVGLA
VGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSSR
SYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPT
DYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTP
STQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctaaggaggttggacaaaatcaggttcagaggtcacaagagagatgacttcctcgat
ctagcggagtctccaaatgcctcggacaccgaatgcagcgacgaaatccccctgaaggta
ccgcggacctcgccccgggacagcgaggagctgagggaccctgctggtccagggaccctc
atcatggccacaggagtccaggactttaaccggacagagtttgatcgactgaatgagatc
aaaggtcacctggaaattgccttattggaaaaacatttcttacaggaggagctccggaag
ctgcgagaagaaaccaacgcggagatgctgcggcaggagctggaccgcgagcggcagcgg
cggatggagctggagcagaaggtgcaggaggtgctgaaggccagaaccgaggagcagatg
gctcagcagcccccaaaagggcaggcccaggccagcaatggagcagagcgccggagccag
gggctgtcctcgcgcctgcagaagtggttctacgagcggtttggggagtacgtggaggac
ttccggttccagcccgaggagaacactgtggagacagaggaacccctgagcgcccgcagg
ttaactgaaaatatgagacggctcaagcgcggtgccaagccggtcactaactttgtgaag
aacctctctgccttatccgactggtactccgtctacacgtctgccattgccttcaccgtg
tacatgaatgccgtgtggcatggctgggccatcccattgttcttatttctagcaattctg
aggttatccctcaattacctcatcgccagggggtggcggatacagtggagcatcgtgccc
gaagtgtctgagcccgtggaacctccaaaggaagacctgactgtgtctgagaagttccag
ctggtgctggacgtcgcccagaaagcccagaaccttttcgggaagatggctgacatcctg
gagaagatcaagaacttgttcatgtgggtccagccggagatcacacagaagctgtatgtg
gcgctctgggctgccttcctggcctcctgcttcttcccctaccgcctggtggggcttgcc
gtgggactctatgctggtatcaagttcttcctcattgatttcatctttaaacgctgcccg
aggctgcgcgccaagtacgacacgccctatatcatctggaggagtctccccaccgacccg
cagctcaaggagcgctccagcgccgcagtctcacgcaggctgcagacgacctcgtcacgg
agctacgtacccagcgcaccggccggcctgggtaaagaggaggacgccggtcgcttccac
agcaccaagaagggcaatttccacgagatcttcaatctgacagaaaacgagcgtccgctg
gcggtgtgcgagaatggctggcgctgctgcctcatcaacagggaccggaagatgcccacg
gactacatcaggaacggggtgctctacgtcacggagaattacttgtgcttcgaaagctcc
aaatctgggtcctcaaagaggaacaaagtcatcaagctagtggacatcacggacatccag
aagtacaaggtcctgtctgtcctcccaggctcaggcatggggattgccgtgtcgacgcca
tccacccagaaaccgctcgtgtttggtgccatggtgcacagggatgaggccttcgagacc
attctcagccagtacatcaagatcacctcagcggcagcgtctggcggggacagctag

DBGET integrated database retrieval system