KEGG   Homo sapiens (human): 2316Help
Entry
2316              CDS       T01001                                 

Gene name
FLNA, ABP-280, ABPX, CSBS, CVD1, FGS2, FLN, FLN-A, FLN1, FMD, MNS, NHBP, OPD, OPD1, OPD2, XLVD, XMVD
Definition
(RefSeq) filamin A
  KO
K04437  filamin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04510  Focal adhesion
hsa05132  Salmonella infection
hsa05205  Proteoglycans in cancer
Disease
H00270  Periventricular nodular heterotopia
H00456  Fronto-otopalatodigital syndromes
H00894  FG syndrome
H01276  Chronic idiopathic intestinal pseudo-obstruction
H01740  Macrothrombocytopenia
H01868  Mitral valve prolapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2316 (FLNA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2316 (FLNA)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    2316 (FLNA)
  09167 Infectious diseases
   05132 Salmonella infection
    2316 (FLNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2316 (FLNA)
   04147 Exosome [BR:hsa04147]
    2316 (FLNA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2316 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    2316 (FLNA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2316 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5
Motif
Other DBs
NCBI-GeneID: 2316
NCBI-ProteinID: NP_001104026
OMIM: 300017
HGNC: 3754
Ensembl: ENSG00000196924
Vega: OTTHUMG00000022712
Pharos: P21333(Tbio)
UniProt: P21333 Q60FE5 Q6NXF2
Structure
PDB: 

Position
Xq28
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgcagcaggcgcggctccgggcggcggc
gtcgacacgcgggacgccgagatgccggccaccgagaaggacctggcggaggacgcgccg
tggaagaagatccagcagaacactttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggcttatcgcgctg
ttggaggtgctcagccagaagaagatgcaccgcaagcacaaccagcggcccactttccgc
caaatgcagcttgagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaaa
ctggtgtccatcgacagcaaggccatcgtggacgggaacctgaagctgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggacgaggaggaggat
gaggaggccaagaagcagacccccaagcagaggctcctgggctggatccagaacaagctg
ccgcagctgcccatcaccaacttcagccgggactggcagagcggccgggccctgggcgcc
ctggtggacagctgtgccccgggcctgtgtcctgactgggactcttgggacgccagcaag
cccgttaccaatgcgcgagaggccatgcagcaggcggatgactggctgggcatcccccag
gtgatcacccccgaggagattgtggaccccaacgtggacgagcactctgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctcccttgcggcccaaactgaac
ccgaagaaagcccgtgcctacgggccaggcatcgagcccacaggcaacatggtgaagaag
cgggcagagttcactgtggagaccagaagtgctggccagggagaggtgctggtgtacgtg
gaggacccggccggacaccaggaggaggcaaaagtgaccgccaataacgacaagaaccgc
accttctccgtctggtacgtccccgaggtgacggggactcataaggttactgtgctcttt
gctggccagcacatcgccaagagccccttcgaggtgtacgtggataagtcacagggtgac
gccagcaaagtgacagcccaaggtcccggcctggagcccagtggcaacatcgccaacaag
accacctactttgagatctttacggcaggagctggcacgggcgaggtcgaggttgtgatc
caggaccccatgggacagaagggcacggtagagcctcagctggaggcccggggcgacagc
acataccgctgcagctaccagcccaccatggagggcgtccacaccgtgcacgtcacgttt
gccggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
agtgcctgccgggcggttggccggggcctccagcccaagggtgtgcgggtgaaggagaca
gctgacttcaaggtgtacacaaagggcgctggcagtggggagctgaaggtcaccgtgaag
ggccccaagggagaggagcgcgtgaagcagaaggacctgggggatggcgtgtatggcttc
gagtattaccccatggtccctggaacctatatcgtcaccatcacgtggggtggtcagaac
atcgggcgcagtcccttcgaagtgaaggtgggcaccgagtgtggcaatcagaaggtacgg
gcctggggccctgggctggagggcggcgtcgttggcaagtcagcagactttgtggtggag
gctatcggggacgacgtgggcacgctgggcttctcggtggaagggccatcgcaggctaag
atcgaatgtgacgacaagggcgacggctcctgtgatgtgcgctactggccgcaggaggct
ggcgagtatgccgttcacgtgctgtgcaacagcgaagacatccgcctcagccccttcatg
gctgacatccgtgacgcgccccaggacttccacccagacagggtgaaggcacgtgggcct
ggattggagaagacaggtgtggccgtcaacaagccagcagagttcacagtggatgccaag
cacggtggcaaggccccacttcgggtccaagtccaggacaatgaaggctgccctgtggag
gcgttggtcaaggacaacggcaatggcacttacagctgctcctacgtgcccaggaagccg
gtgaagcacacagccatggtgtcctggggaggcgtcagcatccccaacagccccttcagg
gtgaatgtgggagctggcagccaccccaacaaggtcaaagtatacggccccggagtagcc
aagacagggctcaaggcccacgagcccacctacttcactgtggactgcgccgaggctggc
cagggggacgtcagcatcggcatcaagtgtgcccctggagtggtaggccccgccgaagct
gacatcgacttcgacatcatccgcaatgacaatgacaccttcacggtcaagtacacgccc
cggggggctggcagctacaccattatggtcctctttgctgaccaggccacgcccaccagc
cccatccgagtcaaggtggagccctctcatgacgccagtaaggtgaaggccgagggccct
ggcctcagtcgcactggtgtcgagcttggcaagcccacccacttcacagtaaatgccaaa
gctgctggcaaaggcaagctggacgtccagttctcaggactcaccaagggggatgcagtg
cgagatgtggacatcatcgaccaccatgacaacacctacacagtcaagtacacgcctgtc
cagcagggtccagtaggcgtcaatgtcacttatggaggggatcccatccctaagagccct
ttctcagtggcagtatctccaagcctggacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagaccaggagttcacagtcaaatcaaagggtgctggtggt
caaggcaaagtggcatccaagattgtgggcccctcgggtgcagcggtgccctgcaaggtg
gagccaggcctgggggctgacaacagtgtggtgcgcttcctgccccgtgaggaagggccc
tatgaggtggaggtgacctatgacggcgtgcccgtgcctggcagcccctttcctctggaa
gctgtggcccccaccaagcctagcaaggtgaaggcgtttgggccggggctgcagggaggc
agtgcgggctcccccgcccgcttcaccatcgacaccaagggcgccggcacaggtggcctg
ggcctgacggtggagggcccctgtgaggcgcagctcgagtgcttggacaatggggatggc
acatgttccgtgtcctacgtgcccaccgagcccggggactacaacatcaacatcctcttc
gctgacacccacatccctggctccccattcaaggcccacgtggttccctgctttgacgca
tccaaagtcaagtgctcaggccccgggctggagcgggccaccgctggggaggtgggccaa
ttccaagtggactgctcgagcgcgggcagcgcggagctgaccattgagatctgctcggag
gcggggcttccggccgaggtgtacatccaggaccacggtgatggcacgcacaccattacc
tacattcccctctgccccggggcctacaccgtcaccatcaagtacggcggccagcccgtg
cccaacttccccagcaagctgcaggtggaacctgcggtggacacttccggtgtccagtgc
tatgggcctggtattgagggccagggtgtcttccgtgaggccaccactgagttcagtgtg
gacgcccgggctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgacggagacctacgttcaggaccgtggcgatggcatgtacaaagtggag
tacacgccttacgaggagggactgcactccgtggacgtgacctatgacggcagtcccgtg
cccagcagccccttccaggtgcccgtgaccgagggctgcgacccctcccgggtgcgtgtc
cacgggccaggcatccaaagtggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacgggcggcctgggcctggctgtagagggcccctccgaggccaagatg
tcctgcatggataacaaggacggcagctgctcggtcgagtacatcccttatgaggctggc
acctacagcctcaacgtcacctatggtggccatcaagtgccaggcagtcctttcaaggtc
cctgtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcccggcctgagccca
ggcatggttcgtgccaacctccctcagtccttccaggtggacacaagcaaggctggtgtg
gccccattgcaggtcaaagtgcaagggcccaaaggcctggtggagccagtggacgtggta
gacaacgctgatggcacccagaccgtcaattatgtgcccagccgagaagggccctacagc
atctcagtactgtatggagatgaagaggtaccccggagccccttcaaggtcaaggtgctg
cctactcatgatgccagcaaggtgaaggccagtggccccgggctcaacaccactggcgtg
cctgccagcctgcccgtggagttcaccatcgatgcaaaggacgccggggagggcctgctg
gctgtccagatcacggatcccgaaggcaagccgaagaagacacacatccaagacaaccat
gacggcacgtatacagtggcctacgtgccagacgtgacaggtcgctacaccatcctcatc
aagtacggtggtgacgagatccccttctccccgtaccgcgtgcgtgccgtgcccaccggg
gacgccagcaagtgcactgtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccccaccattcagattggggaggagacggtgatcactgtggacactaaggcggcaggc
aaaggcaaagtgacgtgcaccgtgtgcacgcctgatggctcagaggtggatgtggacgtg
gtggagaatgaggacggcactttcgacatcttctacacggccccccagccgggcaaatac
gtcatctgtgtgcgctttggtggcgagcacgtgcccaacagccccttccaagtgacggct
ctggctggggaccagccctcggtgcagccccctctacggtctcagcagctggccccacag
tacacctacgcccagggcggccagcagacttgggccccggagaggcccctggtgggtgtc
aatgggctggatgtgaccagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggcgagatcacaggggaggttcggatgccctcaggcaaggtggcgcagcccaccatc
actgacaacaaagacggcaccgtgaccgtgcggtatgcacccagcgaggctggcctgcac
gagatggacatccgctatgacaacatgcacatcccaggaagccccttgcagttctatgtg
gattacgtcaactgtggccatgtcactgcctatgggcctggcctcacccatggagtagtg
aacaagcctgccaccttcaccgtcaacaccaaggatgcaggagaggggggcctgtctctg
gccattgagggcccgtccaaagcagaaatcagctgcactgacaaccaggatgggacatgc
agcgtgtcctacctgcctgtgctgccgggggactacagcattctagtcaagtacaatgaa
cagcacgtcccaggcagccccttcactgctcgggtcacaggtgacgactccatgcgtatg
tcccacctaaaggtcggctctgctgccgacatccccatcaacatctcagagacggatctc
agcctgctgacggccactgtggtcccgccctcgggccgggaggagccctgtttgctgaag
cggctgcgtaatggccacgtggggatttcattcgtgcccaaggagacgggggagcacctg
gtgcatgtgaagaaaaatggccagcacgtggccagcagccccatcccggtggtgatcagc
cagtcggaaattggggatgccagtcgtgttcgggtctctggtcagggccttcacgaaggc
cacacctttgagcctgcagagtttatcattgatacccgcgatgcaggctatggtgggctc
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctggaggacggg
acgtgcagggtcacctactgccccacagagccaggcaactacatcatcaacatcaagttt
gccgaccagcacgtgcctggcagccccttctctgtgaaggtgacaggcgagggccgggtg
aaagagagcatcacccgcaggcgtcgggctccttcagtggccaacgttggtagtcattgt
gacctcagcctgaaaatccctgaaattagcatccaggatatgacagcccaggtgaccagc
ccatcgggcaagacccatgaggccgagatcgtggaaggggagaaccacacctactgcatc
cgctttgttcccgctgagatgggcacacacacagtcagcgtgaagtacaagggccagcac
gtgcctgggagccccttccagttcaccgtggggcccctaggggaagggggagcccacaag
gtccgagctgggggccctggcctggagagagctgaagctggagtgccagccgaattcagt
atctggacccgggaagctggtgctggaggcctggccattgctgtcgagggccccagcaag
gctgagatctcttttgaggaccgcaaggacggctcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaagtctcagtcaagttcaacgaggaacacattcccgacagcccc
ttcgtggtgcctgtggcttctccgtctggcgacgcccgccgcctcactgtttctagcctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
acagaaattgaccaagataagtatgctgtgcgcttcatccctcgggagaatggcgtttac
ctgattgacgtcaagttcaacggcacccacatccctggaagccccttcaagatccgagtt
ggggagcctgggcatggaggggacccaggcttggtgtctgcttacggagcaggtctggaa
ggcggtgtcacagggaacccagctgagttcgtcgtgaacacgagcaatgcgggagctggt
gccctgtcggtgaccattgacggcccctccaaggtgaagatggattgccaggagtgccct
gagggctaccgcgtcacctatacccccatggcacctggcagctacctcatctccatcaag
tacggcggcccctaccacattgggggcagccccttcaaggccaaagtcacaggcccccgt
ctcgtcagcaaccacagcctccacgagacatcatcagtgtttgtagactctctgaccaag
gccacctgtgccccccagcatggggccccgggtcctgggcctgctgacgccagcaaggtg
gtggccaagggcctggggctgagcaaggcctacgtaggccagaagagcagcttcacagta
gactgcagcaaagcaggcaacaacatgctgctggtgggggttcatggcccaaggaccccc
tgcgaggagatcctggtgaagcacgtgggcagccggctctacagcgtgtcctacctgctc
aaggacaagggggagtacacactggtggtcaaatggggggacgagcacatcccaggcagc
ccctaccgcgttgtggtgccctga

KEGG   Homo sapiens (human): 2317Help
Entry
2317              CDS       T01001                                 

Gene name
FLNB, ABP-278, ABP-280, AOI, FH1, FLN-B, FLN1L, LRS1, SCT, TABP, TAP
Definition
(RefSeq) filamin B
  KO
K04437  filamin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04510  Focal adhesion
hsa05132  Salmonella infection
hsa05205  Proteoglycans in cancer
Disease
H00499  Spondylocarpotarsal synostosis syndrome
H02048  Larsen syndrome
H02064  Atelosteogenesis type I and III
H02067  Boomerang dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2317 (FLNB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2317 (FLNB)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    2317 (FLNB)
  09167 Infectious diseases
   05132 Salmonella infection
    2317 (FLNB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2317 (FLNB)
   04147 Exosome [BR:hsa04147]
    2317 (FLNB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2317 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    2317 (FLNB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2317 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 Invasin_D3 CarboxypepD_reg
Motif
Other DBs
NCBI-GeneID: 2317
NCBI-ProteinID: NP_001448
OMIM: 603381
HGNC: 3755
Ensembl: ENSG00000136068
Vega: OTTHUMG00000159158
Pharos: O75369(Tbio)
UniProt: O75369
Structure
PDB: 

Position
3p14.3
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctagctgaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagtgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgagtgttgacaaggcccagggagatgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacctactttgacatctat
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggccctcacgtggtcaagatcttctttgctggggacactattcctaagagt
cccttcgttgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcagcggacttcgtggtagaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggaggctacaaccctgatctggttcgagcatacgggccaggtttggagaaatctggatgc
attgtcaacaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcatgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacggtggactgtactgaggctggggaaggtgatgtcagtgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatatcatcgat
aattatgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
aacagcacggccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
agcaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgatgggacctgctccgtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagctgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcacgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggactcgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaactcgtgccacacttccccgcccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagctaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgcggatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgacgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccagccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggcgcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgcaccgggggattacgatgttaatatcaca
tatggaggagcccacatccccggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggttctg
ggcccacgaggcttggtggagccagtgaacgtggtggacaatggagatggcacacacaca
gtaacctacaccccatctcaggagggaccttacatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaattgatgcccgagatgccggggaaggcctgcttgctgttcaaataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccccgacaagactgggcgctatatgattggagtcacctacgggggtgacgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaagggtaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcattgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccgggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggagaggtccacatgccttctgggaagacagccacacctgagattgtggacaacaag
gacggcacggtcactgttagatatgcccccactgaggtcgggctccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctacgtgaactaccccaac
agtggaagtgtttctgcatacggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgccgactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcagccgctgacttcctgctcgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagacgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggcgaacatctggtcagcatcaagaaa
aatggcaaccatgtggccaacagccccgtgtctatcatggtggtccagtcggagattggt
gacgcccgccgagccaaagtctatggccgcggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcggtggaa
ggccccagcaaagtggacatccagacggaggacctggaagatggcacctgcaaagtctcc
tacttccctaccgtgcctggggtttatatcgtctccaccaaattcgctgacgagcacgtg
cctgggagcccatttaccgtgaagatcagtggggagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtccgtggccactgtcgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaggcagagattgtgcccatggggaagaactcacactgcgtccggtttgtgccccag
gagatgggcgtgcacacggtcagcgtcaagtaccgtgggcagcacgtcaccggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggcgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggcgctggaggcctctccatcgctgttgagggccccagtaaggccgagattacattc
gatgaccataaaaatgggtcgtgcggtgtatcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacatcccggaaagcccctacctggtgccggtc
atcgcaccctccgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcatccctcatgagaatggtgtccacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcctggacaa
gcggggaaccctgccctggtgtccgcctatggcacgggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccagggacattatccgtcacc
atcgaaggcccatccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcagcgtcaaatacggtgggcccaac
cacatcgtgggcagtcccttcaaggccaaggtgacaggccagcgtctagttagccctggc
tcagccaacgagacctcatccatcctggtggagtcagtgaccaggtcgtctacagagacc
tgctatagcgccattcccaaggcatcctcggacgccagcaaggtgacctctaagggggca
gggctctcaaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctcc
atgaagcatgtaggcaaccagcaatacaacgtcacatacgtcgtcaaggagaggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

KEGG   Homo sapiens (human): 2318Help
Entry
2318              CDS       T01001                                 

Gene name
FLNC, ABP-280, ABP280A, ABPA, ABPL, CMH26, FLN2, MFM5, MPD4, RCM5
Definition
(RefSeq) filamin C
  KO
K04437  filamin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04510  Focal adhesion
hsa05132  Salmonella infection
hsa05205  Proteoglycans in cancer
Disease
H00594  Distal myopathy
H00595  Myofibrillar myopathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2318 (FLNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2318 (FLNC)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    2318 (FLNC)
  09167 Infectious diseases
   05132 Salmonella infection
    2318 (FLNC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    2318 (FLNC)
   04147 Exosome [BR:hsa04147]
    2318 (FLNC)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2318 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    2318 (FLNC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2318 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Big_3_5 YtkA
Motif
Other DBs
NCBI-GeneID: 2318
NCBI-ProteinID: NP_001449
OMIM: 102565
HGNC: 3756
Ensembl: ENSG00000128591
Vega: OTTHUMG00000023627
Pharos: Q14315(Tbio)
UniProt: Q14315 Q59H94
Structure
PDB: 

Position
7q32.1
AA seq 2725 aa AA seqDB search
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT
RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP
NT seq 8178 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgatgagacagacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccatccgcgccccaacttccgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctcgagcgcgagcacatcaagctcgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacagacg
cccaagcagcggctgcttggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggacggcaaagctctgggcgccctggtggacaactgcgccccc
ggtctctgccccgactgggaggcctgggaccccaaccagcccgtggagaacgcccgggag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatt
gtggaccccaacgtggatgagcattctgttatgacctacctgtcccagttccccaaggcc
aagctcaaacctggtgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacaccgtgctgcagcctgcccacttcaccgtg
cagacggtggacgcgggcgtgggcgaggtgctggtctacatcgaggaccctgaaggccac
accgaggaggctaaggtggttcccaacaatgacaaggatcgcacctatgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cgcagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggccctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcgggggccggcactggcgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtggccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgccatggaggggccacataccgtgcatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccatgtgtcggaagcctgtaaccccaacgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgcgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacggtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggatggtgtgttcgagtgcgagtactacccggtg
gtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagccgattttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgacgac
aagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgctgtg
cacgtcatctgtgacgatgaggacatccgagactcacccttcattgcccacatcctgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctacc
ggctgcatcgtggacaagcccgctgagttcaccattgatgctcgtgcagctggcaaggga
gacctgaagctctatgcccaggacgccgacggctgtcccatcgacatcaaggtgatcccc
aacggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtaaaggtgtacggccccggagtggagaagacaggcctcaag
gccaatgagcccacctacttcacggtggactgcagcgaggcggggcaaggcgacgtgagc
atcggcatcaagtgcgccccaggcgtggtgggccctgcagaggctgacattgacttcgac
atcatcaagaatgacaacgacaccttcaccgtcaagtacacgccaccaggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagtcgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagctggatgtgcagtttgcagggacagccaagggcgaggttgtgcgggactttgagatc
atagacaaccatgactactcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacttatggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggccttaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcagggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggtgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggatatc
acctacgatggtcacccggtgcctggcagcccgtttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttatggcccgggtctcaagggtggactggtaggcaccccc
gcgccattctccatcgacaccaagggggctggcacaggtggcctggggctgaccgtagag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgctgaggcccacatc
cctggctcgcccttcaaagccaccattcggcctgtgtttgacccgagcaaggtgcgggcc
agtggaccgggcctggagcgcggcaaggtcggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcggagctgaccattgagatcctgtcggatgccggggtcaaggcc
gaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagccctgccttc
cctggcacctacaccattaccatcaagtatggcgggcatcccgtgcccaaattccccacc
cgtgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacacggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcccta
acagccacaggcggcaaccacgtgacggctcgtgtgctcaacccctcgggggccaagaca
gacacctatgtgacagacaatggggacggcacctaccgagtgcagtacaccgcctacgag
gagggcgtgcatctggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggcgtgaccgagggctgtgatcccacccgcgtccgagccttcgggccaggcctg
gagggtggcttggtcaacaaggccaaccgattcactgtggagaccaggggagcgggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcaccgtggagtacatccccttcactcctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccgttccgcgtgccagtgaaggatgtg
gtggaccctgggaaggtgaagtgctcagggccagggctgggggctggtgtcagggcccgg
gttcctcagaccttcacagtggactgcagtcaagctggccgggcgcccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgacgggccctacacggtagccgtcaagtatgct
gaccaggaggtgccacgcagccccttcaagatcaaggtcctcccagctcatgatgccagc
aaggtgcgggccagcggcccaggcctcaacgcctctggcatccctgccagcctgcctgtg
gagttcaccatcgacgcacgggacgcgggcgaggggttgctcactgtccagatcttggac
cccgagggtaagcccaagaaggccaacatccgggacaatggggatggcacgtacactgtg
tcctacctgccggacatgagtggccggtacaccatcaccatcaagtatggcggtgatgag
atcccctactcgcccttccgcatccatgctctgcccactggggatgccagcaagtgcctc
gtcacagtgtccattggaggccatggcctgggtgcctgcctgggccctcgaatccagatt
gggcaggagacggtgatcacggtggatgccaaggcagccggtgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggatgtggttgagaaccatgacggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggtgagcacatccccaacagccccttccacgtgctggcgtgtgaccccctgccgcac
gaggaggagccctctgaagtgccacagctgcgccagccctacgctcctccccggcccggc
gcccgccccacacactgggccacagaggagccagtggtgcctgtggagccaatggagtcc
atgctgaggcccttcaacctggtcatccccttcgcggtgcagaaaggggagctcacagga
gaggtgcggatgccctcggggaagacggcacggcccaacatcaccgacaacaaggacggc
accatcacggtgaggtatgcacccactgagaaaggcctgcaccagatggggatcaagtat
gacggcaaccacatccctgggagccccttacagttctatgtggatgccatcaacagccgc
catgtcagtgcctatgggccaggcctgagccatggcatggtcaacaagccagccaccttc
actattgtcaccaaagatgctggagaagggggtctgtcactggccgtggagggcccatcc
aaggcagagatcacctgtaaggacaacaaggatggcacctgcaccgtgtcctatctgccg
actgcgcctggagactacagcatcatcgtgcgcttcgatgacaagcacatcccggggagc
cccttcacagccaagatcacaggtgatgactccatgaggacctcacagctgaatgtgggc
acctccacggacgtgtcactgaagatcaccgagagtgatctgagccagctgaccgccagc
atccgtgccccctcgggcaacgaggagccctgcctgctgaagcgcctgcccaaccggcac
attgggatctccttcacccccaaggaggtcggggagcacgtggtgagcgtgcgcaagagt
ggcaagcatgtcaccaacagccccttcaagatcctggtggggccatctgagatcggggac
gccagcaaggtgcgggtctggggcaaggggctttccgagggacacacattccaggtggca
gagttcatcgtggacactcgcaatgcaggttatgggggcttggggctgagtattgaaggc
ccaagcaaggtggacatcaactgtgaggacatggaggacgggacatgcaaagtcacctac
tgccccaccgagcccggcacctacatcatcaacatcaagtttgctgacaagcacgtgcct
ggaagccccttcactgtgaaggtgaccggcgagggccgcatgaaggagagcatcacccgg
cggagacaggcaccttccatcgccaccatcggcagcacctgtgacctcaacctcaagatc
ccaggaaactggttccagatggtgtctgcccaggagcgcctgacacgcaccttcacacgc
agcagccacacctacacccgcacggagcgcacggagatcagcaagacgcggggcggggag
acaaagcgcgaggtgcgggtggaggagtccacccaggtcggcggggaccccttccctgct
gtgtttggggacttcctgggccgggagcgcctgggatccttcggcagcatcacccggcag
caggagggtgaggccagctctcaggacatgactgcacaggtgaccagcccatcgggcaag
gtggaagccgcagagatcgtcgagggcgaggacagcgcctacagcgtgcgctttgtgccc
caggaaatggggccccatacggtcgctgtcaagtaccgtggccagcacgtgcccggcagc
ccctttcagttcactgtggggccgctgggtgaaggtggtgcccacaaggtgcgggccgga
ggcacagggctggagcgaggtgtggccggcgtgccagccgagttcagcatctggacccgg
gaggctggcgctgggggcctgtccattgctgtggagggtcctagcaaagcggagattgca
tttgaggatcgcaaagatggctcctgcggcgtctcctatgtcgtccaggaaccaggtgac
tatgaggtctccatcaagttcaatgatgagcacatcccagacagcccctttgtggtgcct
gtggcctccctctcggatgacgctcgccgtctcactgtcaccagcctccaggagacgggg
ctcaaggtgaaccagccagcgtcctttgccgtgcagctgaacggtgcccggggcgtgatt
gatgcccgggtgcacacaccctcgggggctgtggaggagtgctacgtctctgagctggac
agtgacaagcacaccatccgcttcatcccccacgagaatggcgtccactccatcgatgtc
aagttcaacggtgcccacatccctggaagtcccttcaagatccgcgttggggagcagagc
caggctggggacccaggcttggtgtcagcctacggtcctgggctcgagggaggcactacc
ggtgtgtcatcagagttcatcgtgaacaccctgaatgccggctcgggggccttgtctgtc
accattgatggcccctccaaggtgcagctggactgtcgggagtgtcctgagggccatgtg
gtcacttatactcccatggcccctggcaactacctcattgccatcaagtacggtggcccc
cagcacatcgtgggcagccccttcaaggccaaggtcactggtccgaggctgtccggaggc
cacagccttcacgaaacatccacggttctggtggagactgtgaccaagtcctcctcaagc
cggggctccagctacagctccatccccaagttctcctcagatgccagcaaggtggtgact
cggggccctgggctgtcccaggccttcgtgggccagaagaactccttcaccgtggactgc
agcaaagcaggcaccaacatgatgatggtgggcgtgcacggccccaagaccccctgtgag
gaggtgtacgtgaagcacatggggaaccgggtgtacaatgtcacctacactgtcaaggag
aaaggggactacatcctcattgtcaagtggggtgacgaaagtgtccctggaagccccttc
aaagtcaaggtcccttga

DBGET integrated database retrieval system