KEGG   Homo sapiens (human): 23161
Entry
23161             CDS       T01001                                 

Gene name
SNX13, RGS-PX1
Definition
(RefSeq) sorting nexin 13
  KO
K17925  sorting nexin-13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    23161 (SNX13)
SSDB
Motif
Pfam: PXA Nexin_C PX RGS Swi3 COX5A
Other DBs
NCBI-GeneID: 23161
NCBI-ProteinID: NP_055947
OMIM: 606589
HGNC: 21335
Ensembl: ENSG00000071189
Vega: OTTHUMG00000152730
Pharos: Q9Y5W8(Tbio)
UniProt: Q9Y5W8 A0A024R9Z9 Q86XC4
Position
7p21.1
AA seq 957 aa
MLTEASLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLE
QCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGD
FQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTV
KLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPE
IFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPT
GSINLSLDDLSNVSSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRNLNSEEMWKTYR
RYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMK
ASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTK
MSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLM
DEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDA
FWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQH
NQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgttaactgaggccagtctatccatatggggatggggaagccttggcattgtccttttt
ctgataacctttggaccctttgtaatattttatttgacattttatatcctctgctttgtg
ggtgggggtttagtggttactctcctgtttggaaaaacaaactcagagaagtacctagaa
cagtgtgaacactcatttcttcctccaacatcacctggggttcctaagtgcttagaagaa
atgaaacgggaagccaggactattaagattgatagaagattgacgggtgccaatataatt
gatgaacctctccagcaagttatccagttttccttgagggattatgtccagtattggtat
tatacactaagcgatgatgaatcttttcttcttgaaattaggcagactcttcaaaacgca
ctcattcagtttgctactaggtcaaaagaaatagactggcaaccttattttactacacgc
attgtagatgactttggcacacacttacgagtattcagaaaggctcaacagaaaataaca
gagaaagatgatcaagtgaaaggtacagcagaagatcttgtagataccttctttgaagtt
gaagttgaaatggagaaggaggtttgccgtgatctagtgtgcacttcccccaaagatgaa
gaaggattcctaagggatttgtgtgaggtcttactatatttattgctacctcctggagat
ttccagaacaagatcatgcgatactttgtcagggaaatccttgcacgaggaattcttctt
ccattaataaatcaactcagtgatcctgattatattaatcagtatgtcatatggatgatc
cgtgattctaactgcaactatgaggcctttatgaacattattaaattgagtgacaatatt
ggagagctagaagcagtcagagataaggcagcagaagaattacagtatcttagatctcta
gatacagctggtgatgatatcaacactatcaaaaatcaaataaatagcttactattcgta
aagaaggtatgtgactcaagaatacagcgattgcagtcaggcaaagaaataaatactgtg
aaacttgcagcaaactttgggaaactttgcacagtccccctggacagcattcttgtagac
aatgttgcactacaattttttatggattacatgcagcaaactggaggtcaagcacatcta
ttcttttggatgacagtggaaggataccgggttaccgcccaacagcagctagaagtttta
ttaagtcgtcagagagatggaaaacatcaaaccaaccaaaccaaaggtcttttaagagca
gctgctgttggaatttatgaacagtatttatcagaaaaggcatctccaagagttactgtt
gatgactatttagtagcaaaattagcagatactttgaatcatgaagatccaacccctgaa
atctttgatgacattcaaagaaaggtatatgaattgatgctacgagatgaaagattttat
ccttccttcagacagaatgcactttatgtgcgcatgttagctgagcttgacatgttaaaa
gatcctagtttcagaggatccgatgatggggatggagaatcttttaatgggtctcctaca
ggaagcataaatttgtctttagatgacctttcaaatgtttcttctgatgactcagtacaa
cttcatgcctacatttcagacacaggcgtttgtaatgatcatggcaagacatatgcatta
tatgccatcactgtacaccggcgcaacctaaacagtgaggagatgtggaaaacctatcgt
cgttatagtgacttccatgacttccacatgagaatcactgaacagtttgaaagtctctca
agcatattgaaacttcctggaaaaaagacttttaataatatggatagagattttttagaa
aagagaaaaaaggatctaaatgcatatttgcagttactgttagctcctgaaatgatgaag
gcatcccccgctttagctcactatgtgtatgatttccttgagaacaaagcctacagtaaa
ggaaaaggggattttgctcgcaagatggacacttttgtaaatccacttcgcaattcaatg
aggaatgtttcaaatgcagttaaatcccttcctgatagcttggcagagggaatgactaaa
atgtcagacaacatgggcaaaatgtcagaaagattaggtcaagacataaagcaatcattt
tttaaggtgcctcctttaattcctaagactgattcagaccctgaacatcgccgagtttcg
gctcaacttgacgataatgtggatgacaatattccacttagggtaatgctgcttctcatg
gatgaagtattcgacttaaaagaaagaaatcagtggttgcgaaggaatatcaaaaaccta
cttcaacagcttattagagctacatatggcgatactattaatagaaaaatagttgaccat
gttgactggatgacttcacctgaacaagtagccgactcagtgaaacgtttcagagatgca
ttttggccaaatggcattttagcagaggctgttccatgcagagataaaagtattcgaatg
agaacaagagtagcaggaaaaacgaaattacttgcaattatgccagatgagctgaagcac
attattggggctgagacaacacggaaaggtattcttcgtgtttttgaaatgtttcagcac
aaccaattaaataggagaatggtttatgtcttcttggaaggctttttagaaaccttattt
ccacagtataaattccgtgaacttttcaacaaactgcattcacggtcaaagcagatgcag
aaatataaacagaaacttcaaactactcaagcgccttctttgcagaaaaggtga

DBGET integrated database retrieval system