KEGG   Homo sapiens (human): 23162Help
Entry
23162             CDS       T01001                                 

Gene name
MAPK8IP3, JIP-3, JIP3, JSAP1, SYD2, syd
Definition
(RefSeq) mitogen-activated protein kinase 8 interacting protein 3
  KO
K04436  mitogen-activated protein kinase 8 interacting protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23162 (MAPK8IP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jnk-SapK_ap_N JIP_LZII Atg14 Rootletin ERM DUF1759
Motif
Other DBs
NCBI-GeneID: 23162
NCBI-ProteinID: NP_055948
OMIM: 605431
HGNC: 6884
Ensembl: ENSG00000138834
Vega: OTTHUMG00000128637
Pharos: Q9UPT6(Tbio)
UniProt: Q9UPT6
Structure
PDB: 

Position
16p13.3
AA seq 1336 aa AA seqDB search
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQ
LQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGV
GSKNSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRLD
RTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEV
GNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELE
EELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKE
RLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY
KSPTTAGFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGR
LQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRP
NEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTL
TTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGAD
GVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATE
VPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTRPEPEPSGDP
TGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGT
LAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKS
FDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKL
GFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARP
GGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDS
PAEGPGPAAPASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSK
AERSHIIVWQVSYTPE
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgatggagatccagatggacgagggcggcggcgtggtggtgtaccaggacgactactgc
tccggctcggtgatgtcggagcgggtgtcgggcctggcgggctccatctaccgcgagttc
gagcgcctcatccactgctacgacgaggaggtggtcaaggagctcatgccgctggtggtg
aacgtgctggagaacctagactcggtgctcagcgagaaccaggagcacgaggtggagctg
gagctgctgcgcgaggacaacgagcagctgctcacccagtacgagcgtgagaaggcgctg
cgcaggcaggcggaggagaaattcattgagtttgaagatgctctggaacaagagaagaaa
gagctgcaaatccaggtggagcactacgagttccagacgcgccagctggagctgaaggcc
aagaactatgccgatcagatttcccggttggaggagcgggagtcggagatgaagaaggag
tacaatgccctgcaccagcggcacacagagatgatacagacctacgtggagcacattgag
aggtccaagatgcagcaggtcggaggaaacagccagaccgagagcagcctgccggggcgg
aggaaggagcgccccacctccctgaacgtgttccccctggctgacggcacggtacgtgca
cagatcgggggcaagctcgtgcctgcgggggaccactggcacctgagtgacctcggccag
ctgcagtccagctccagctaccagtgtccacaggatgaaatgtccgagtcaggccagtcc
tcggcggccgccacacccagcaccacaggcaccaagtccaacacgcccacatcctccgtg
ccctcggccgccgtcacacccctcaacgagagcctgcagcccctgggggactatggcgtg
ggctccaagaacagcaagcgtgcccgggagaagcgcgacagccgcaacatggaagtacag
gtcacccaggagatgcgcaacgtcagtataggcatgggcagcagtgacgagtggtctgat
gttcaagacattattgactccacgccagagctggacatgtgtccagagacccgcctggac
cgcacaggaagcagcccaacccagggcatcgtgaacaaagctttcggcatcaacaccgac
tccctgtaccatgagctgtcgacggcagggtctgaggtcatcggggatgtggacgaaggg
gccgacctcctaggggagttctcagtgcgcgatgatttctttggaatgggcaaagaagtg
gggaatctgctactggaaaactcacagcttctggaaaccaaaaacgccttgaatgtggtg
aagaatgacctgattgccaaggtcgaccagctgtccggggagcaggaggtgctgaggggc
gagttggaggctgctaagcaggccaaagtcaagctggaaaaccgtatcaaggagctggaa
gaggaactgaaaagagtgaagtccgaggccatcatcgcccgccgtgaacccaaagaagag
gcggaggatgtaagcagctatctctgtacagaatcggacaaaatccccatggcccagcgc
cgccgcttcacgcgggtggagatggcccgtgtgctcatggagcggaaccagtacaaggag
cggctgatggagctgcaggaggctgtgcggtggactgagatgatcagagcgtcccgagag
cacccatccgtccaggagaagaagaagtcgaccatctggcagttcttcagccgcctcttc
agctcttcctccagcccccctccggccaagcgcccctatccctcggtgaacatccactac
aagtcacccaccactgccggcttcagccagcgccgcaaccatgccatgtgcccgatctcg
gcaggcagccggcccctggaattcttccctgacgacgactgcacgtcctccgcccgtcga
gagcagaagcgcgagcagtaccgccaggtgcgtgagcacgtgcgtaacgacgacggccgt
ctgcaggcctgcggctggagcctgcccgccaagtacaagcagctgagtcccaacgggggc
caggaggacacgcggatgaagaacgtgccggtgccggtgtactgccgccctctggtggag
aaggaccccaccatgaagctgtggtgtgccgcgggcgtcaacctgagcgggtggaggccc
aatgaggacgacgctgggaatggagtcaagccagcgccaggccgcgatcccctgacctgc
gaccgcgaaggagacggcgagcccaagagcgcccacacgtctcccgagaagaagaaggcc
aaggagctccctgaaatggacgccacctccagccgggtgtggatcctgaccagcaccctg
accaccagcaaggtggtgatcatcgacgccaaccagccgggcacggtggtggaccagttc
accgtctgcaacgcgcacgtgctgtgcatctccagcatccccgcggccagcgacagcgac
taccctcccggggagatgttcctggacagcgacgtgaacccagaggacccgggcgcagat
ggcgtgctggccggtatcaccctggtgggctgtgccacccgctgcaacgtgccgcggagc
aactgctcctcccgaggggacaccccagtgctagacaaggggcagggggaggtggccacc
atcgccaacgggaaggtcaacccgtcccagtccacagaggaggccacagaggccacggag
gtgccagaccctgggcccagcgagccagagacagccacattgcggcccgggcctctcaca
gagcacgtcttcactgacccagccccgaccccgtcctctggcccccagcctggcagcgag
aacgggccagagcctgacagcagcagcacacggccagagccagagcccagcggggacccc
acgggagcaggcagcagtgctgcacccaccatgtggctgggagcccagaacggctggctc
tatgtgcactcggctgtggccaactggaagaagtgcctgcactccatcaagctgaaggat
tctgtgctgagcctggtgcatgtcaaaggccgtgtgctggtggctctggcggacgggacc
ctggccatcttccaccgtggtgaagatggccagtgggatctgagcaactatcacctaatg
gacctgggccacccgcaccactccatccgctgcatggctgttgtgtacgaccgcgtgtgg
tgtggctacaagaacaaggtgcacgtcatccagcccaagaccatgcagatagagaagtca
tttgacgcccacccgcggcgggagagccaggtgcggcagctggcgtggatcggcgatggc
gtatgggtgtccatccgcctggactccaccctgaggctctaccatgcacacacgcaccag
catctacaggacgtggacattgagccctacgtcagcaagatgctaggcactggcaagctg
ggtttctccttcgtacgcatcacggccctgcttgtcgcgggcagccggctctgggtgggc
accggcaacggagtggtcatctccatccccctgacagagactgtggtcctgcaccgaggc
cagctcctggggctccgagccaataagacatcccccacctctggggagggcgcccgtccc
gggggcatcatccacgtgtatggcgatgacagcagtgacagggcggccagcagcttcatc
ccctactgctccatggcccaggcccagctatgcttccatgggcaccgcgatgccgtgaag
ttctttgtctcggtgccagggaacgtgctggccaccctgaatgggagtgtgctggacagc
ccagccgagggccctgggccagctgcccctgcctcggaggtcgagggccagaagctgcgg
aacgtgctggtgctgagcggcggggagggctacatcgacttccgcattggagacggagag
gacgacgagacggaggagggcgcaggggacatgagccaggtgaagcccgtgctgtccaag
gcagagcgcagtcacatcatcgtgtggcaggtgtcctacacccccgagtga

DBGET integrated database retrieval system