KEGG   Homo sapiens (human): 23163Help
Entry
23163             CDS       T01001                                 

Gene name
GGA3
Definition
(RefSeq) golgi associated, gamma adaptin ear containing, ARF binding protein 3
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    23163 (GGA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23163 (GGA3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   GGA
    23163 (GGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS Alpha_adaptinC2 GGA_N-GAT GAT HBM SesA DUF2935 DUF3891 RapA_C
Motif
Other DBs
NCBI-GeneID: 23163
NCBI-ProteinID: NP_619525
OMIM: 606006
HGNC: 17079
Ensembl: ENSG00000125447
Vega: OTTHUMG00000179483
Pharos: Q9NZ52(Tbio)
UniProt: Q9NZ52 A8K6M0
Structure
PDB: 

Position
17q25.1
AA seq 723 aa AA seqDB search
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDS
SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
VINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPP
QASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAG
SSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPL
IPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS
GTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQW
GNL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggaaggggaaagcctggagtcctggctcaataaagccaccaatccttcc
aaccgccaggaggactgggaatacataattggcttctgtgatcagatcaacaaggagctg
gaagggccacagatcgccgtccgactgctggcccacaagatccagtccccacaggaatgg
gaggcgctccaggccctgacggtgctggaggcatgcatgaagaactgtgggaggagattt
cataacgaagtggggaagttccgctttttgaatgagttaatcaaagtcgtctctccaaag
tacctgggggacagggtgtctgagaaagtgaagaccaaggttattgagctgctgtacagc
tggaccatggccctgccagaagaagcaaagatcaaagacgcctaccacatgctgaagaga
cagggcatagtgcagtctgacccaccaattcctgtggataggacgctgatcccctctcca
ccacctcgtcccaaaaaccctgtttttgatgatgaggagaagtccaagcttttagccaag
ctgctgaaaagcaaaaacccagatgacctgcaggaggccaacaagctcatcaagtccatg
gtgaaggaagacgaggcacggatccagaaggtgaccaagcgtctgcacacgttagaggaa
gttaacaacaacgtgagactgctcagtgagatgctgcttcattacagccaggaggactct
tcggacggggacagagagctgatgaaggagctgtttgatcagtgtgagaacaagaggcgg
actttatttaaactcgccagtgagactgaggacaatgataacagtttgggggacatcctg
caagccagtgacaacctctcccgggtcatcaactcttacaaaacaattattgaagggcag
gtcatcaatggcgaggtggctaccttaaccctgcctgactcggaaggaaacagtcagtgc
agtaaccaaggcacgctcatcgaccttgcggagctggacacgaccaacagtttgtcctcc
gtgttggccccagcacctactccaccctcctcaggcatcccaatcctccctccaccaccc
caggcctcaggacctccacggagccgctcctctagccaggccgaggccaccctggggccc
agcagcacaagcaacgccctctcctggctggacgaggagctactctgcttgggcctcgcc
gacccagcccctaatgttcctcccaaagagtcagctgggaacagccagtggcacctgctc
cagagggaacagtccgacctggacttcttcagccccaggccggggaccgctgcctgtggc
gcctccgatgctcctctgctccagccctcagccccctcctcaagcagctcccaagctcca
ctgccgcctcccttcccagctcctgtggtcccagccagtgttcctgcccccagtgcgggc
tcctccttgttttctactggagtggccccagccttggccccaaaagttgagcccgcagtc
cctgggcaccatggcttggcgttgggcaacagcgcgctgcaccacctggatgccctcgat
cagcttctagaagaggccaaagtgacctcgggcttggtgaaacccactacctcccctctc
atccccaccaccaccccagccaggcccctcctgcccttctccacggggcccggcagcccg
ctcttccagccactgagtttccagtcccagggcagccccccgaaggggcctgagctctcc
ctggccagcatccacgtgcccctggaatcgatcaagcctagcagtgcccttcctgtgaca
gcctacgataaaaacggcttccgcatcctcttccactttgccaaggagtgtcccccagga
cgacctgacgtgctggtggtggtggtgtccatgctgaacacggctcccttacctgtcaag
agcatcgtgctgcaggctgcagtgcccaagtcaatgaaagtgaagttgcagccaccttct
gggacagaactctctccatttagccccatccagccacctgcagccatcacccaggtcatg
ttgctggccaatccactgaaggagaaggtgcggcttcggtataagctgaccttcgccctg
ggggagcagctgagcacagaggtgggcgaggtggaccagttccctcctgtggaacagtgg
gggaacctatga

DBGET integrated database retrieval system