KEGG   Homo sapiens (human): 23174
Entry
23174             CDS       T01001                                 

Gene name
ZCCHC14, BDG-29, BDG29
Definition
(RefSeq) zinc finger CCHC-type containing 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-CCHC SAM_1 SAM_2
Other DBs
NCBI-GeneID: 23174
NCBI-ProteinID: NP_055959
HGNC: 24134
Ensembl: ENSG00000140948
Vega: OTTHUMG00000137655
Pharos: Q8WYQ9(Tdark)
UniProt: Q8WYQ9
Position
16q24.2
AA seq 1086 aa
MVEKRCPLQRDGVYRWFSELPSPQRVEFLCGLLDLCIPLELRFLGSCLEDLARKDYHSLR
DSEIKANNPADLGSLTNLTDEVVRSKLLVSLALLGSEQREAAGVLYRTLTHIDSIIHNYG
LQLNEGRTGDEFLLLFTMASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGG
ALPTCPACHKITPRTEAPVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLK
GLSHTKNDRNVECSFEVLWSDSSITSVTKSSSEVTEFISKLCQLYPEENLEKLIPCLAGP
DAFYVERNHVDLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGT
VMGVSGRPVCGVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPA
ILMPSSLQTPQTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGA
KKKLKTQLELEKEKSERRCLNPSAPPLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEV
EQPHHQLPREGSSSEYSSSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLN
HFTSSSARPTAQVLPVQNEASSNPSGHHPLPPQMLSAASHITPIRMLNSVHKPERGSADM
KLLSSSVHSLLSLEERNKGSGPRSSMKVDKSFGSAMMDVLPASAPHQPVQVLSGLSESSS
MSPTVSFGPRTKVVHASTLDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSS
SVPADSAISGQTSCPNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCAN
SNTASPSSHPSTSFANMATLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIPASNPNH
HHHHHHQQPPAPPQPAPPPPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFP
FLPFSPMCSSGYVSAQQYGGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTA
GVYQTQGLVGSSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAE
SLDSTD
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggtggagaagcgctgcccgctgcagagggacggcgtgtaccgctggttctcggagctg
ccgtcgccgcagcgcgtggagttcctgtgcggcctgctggacctgtgcatcccgctcgag
cttcgcttcctcggctcgtgcctggaggacctggcccgcaaggactaccactcgctgcgc
gactcggagatcaaggccaacaacccggccgacctgggcagcctcaccaacctgacggac
gaggtggtgcgcagcaagctgctggtgtcgctggcgctgctgggctcggagcagcgcgag
gcggcgggcgtgctctaccgcacgctcacgcacatcgactccatcatccacaactacggg
ctgcagcttaacgagggccgcacgggcgatgagttcctgctgctgttcaccatggcctcc
aaccacccggccttcagcttccaccagaagcaggtgctgcgccaggagctcacgcagatc
cagagcagcctgaacggcggcgggggccacggcggcaagggcgcgcccgggccgggcggc
gcgctgcccacttgcccagcctgccacaagatcactccaagaactgaggcccctgtcagc
agtgtcagtaatagtttggagaatgccctgcacacatcagcacattccacggaggagtcg
ctgcccaagaggcccttaggaaaacacagcaaagtgagtgttgaaaagatagacctgaag
ggattatcacacacaaaaaatgacagaaatgttgaatgttcctttgaggtcttgtggtct
gattcttcaataacatcagtaaccaaatcttcctctgaagtgacggaatttatttcaaag
ctatgtcagctctatcctgaagagaacttggagaaactcattccttgcttagctggtccg
gacgcattttatgtggagcgaaaccacgtggatctggactcaggcctgaggtacctggcc
tcattaccttctcacgtgttgaaaaatgaccatgtcaggaggtttctcagcacttcctct
cccccacagcagcttcagagtccaagtcctggcaatccctccctttctaaagtaggtacc
gtgatgggcgtgtctggaaggcctgtgtgtggagtggctggtatcccgtcctcgcagagc
ggagcccagcaccacgggcagcacccggccggctccgccgcccccttgcctcactgctcc
catgcgggcagcgcgggctcagccctggcctaccggacccagatggacacatcacctgcc
atcctcatgccttccagtctgcagacccctcagacccaggagcagaatgggattctagac
tggcttaggaaactgcgtttgcacaagtattaccccgtctttaagcagctctccatggag
aagtttttgagccttactgaagaagatctgaataaatttgagtctcttaccatgggggca
aagaagaagctcaagacccagctggagctggaaaaggagaagtcagagagacggtgcctg
aacccctcggccccgccgctggtcaccagcagtggtgtggctcgagtgccccccaccagc
cacgtcgggcccgtgcagtcggggcggggcagccatgcagcagagctgcgggtggaagtg
gagcagccccatcaccagctgccccgggaaggcagttcctcggagtactccagctcctcc
tccagccccatgggggtacaggcccgggaagagagctccgacagcgctgaggagaatgac
agacgtgtggagattcacttggagagctctgacaaggagaagccggtgatgctgctgaat
cacttcacttccagttccgccagacccacggcccaggttctccctgtgcagaatgaggcc
agctccaatccatcaggccaccaccccctgcccccgcagatgctgagcgcagcctcacac
atcacacccatccgcatgctgaattccgtgcacaagccggaaagagggagcgcggacatg
aagctcctctcgtcttctgtgcactcacttttgtctctagaagaaaggaataaaggatct
ggaccaagaagcagcatgaaagtggacaagagctttggcagcgccatgatggacgtgctg
cccgcgtccgcaccccaccagcctgtgcaggtcctctctgggctttcggagagcagctcc
atgtcacccacagtctcctttggtccccggaccaaagtcgtgcatgcatccacgctggac
agggtgctgaagacagcacagcaaccggccctggtcgtggagaccagcacggccgccacg
gggacgcccagcacagtcctccacgccgcccgtccgcccatcaaactgctgctgtcgtca
tctgttcctgctgattctgccatttctgggcaaacttcctgtcctaataatgtgcaaata
agtgtgccccctgcaataataaacccccggactgctctgtacacagccaacaccaaagtt
gccttttctgcaatgagcagtatgccagtgggccccctgcagggtggcttctgtgcaaac
agcaacactgcctctcccagcagccacccctccacgtcctttgccaacatggccacgttg
cccagctgcccagcccccagctccagcccggcgctgtcctccgtccctgaaagcagtttc
tatagcagcagtggcggtggcggctccacaggaaacattcctgcctcgaatccgaaccac
caccaccaccaccaccatcagcagcccccggcacccccgcagcccgccccacccccgcca
ggctgcattgtgtgcacgtcctgtggctgcagcggcagctgcggctcgagtggcctgact
gtcagctacgccaactacttccagcacccgttctccggtccgtccgtgttcaccttcccc
ttcttgcccttcagtcccatgtgcagcagcggctacgtcagcgcccagcagtacggcggc
ggctccaccttccccgtcgtgcacgccccttacagcagcagcgggaccccagaccctgtc
ctgagtgggcagtccacgtttgccgtgccacccatgcagaacttcatggcagggacagca
ggggtgtaccagacccaaggactggtgggcagtagcaatggttccagtcacaaaaagagc
gggaacctatcttgttacaactgcggggccactggtcaccgcgcccaggactgcaaacag
ccgtccatggacttcaaccggccaggtacttttaggttgaaatacgcccctccagcagaa
agtctggactccacagattga

DBGET integrated database retrieval system