KEGG   Homo sapiens (human): 23175Help
Entry
23175             CDS       T01001                                 

Gene name
LPIN1, PAP1
Definition
(RefSeq) lipin 1
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04150  mTOR signaling pathway
Module
hsa_M00089  Triacylglycerol biosynthesis
Disease
H01290  Acute recurrent myoglobinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    23175 (LPIN1)
   00564 Glycerophospholipid metabolism
    23175 (LPIN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    23175 (LPIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23175 (LPIN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     23175 (LPIN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   23175 (LPIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LNS2 Lipin_N Lipin_mid WRNPLPNID
Motif
Other DBs
NCBI-GeneID: 23175
NCBI-ProteinID: NP_663731
OMIM: 605518
HGNC: 13345
Ensembl: ENSG00000134324
Vega: OTTHUMG00000119082
Pharos: Q14693(Tbio)
UniProt: Q14693
Position
2p25.1
AA seq 890 aa AA seqDB search
MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRS
REKVVDIEINGESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQL
KRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDED
MFPIEMSSDEAMELLESSRTLPNDIPPFQDDIPEENLSLAVIYPQSASYPNSDREWSPTP
SPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQAAKSSSPHKMKESSPLSSRK
ICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLETLGAAAPLLPM
IEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITK
DAFLEQAVSYQQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVES
IMRDKMPKKGGRWWFSWRGRNTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSS
SDEERAAAKPSNAGHLPLLPNVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCR
CEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFL
YCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCL
TDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgtggggcagttagccggccaggtgtttgtcaccgtgaaggagctctacaag
gggctgaatcccgccacactctcagggtgcattgacatcattgtcatccgccagcccaat
ggaaacctccaatgctcccctttccacgtccgctttgggaagatgggggtcctgcgctcc
cgagagaaagtggttgacatagaaatcaatggggaatctgtggatttgcatatgaaattg
ggagataatggagaagcattttttgttcaagaaacagataatgatcaggaagttatccct
atgcacctggccacctcccccatcctgtcagaaggagcttcgagaatggaatgccagctg
aaaaggggctctgtggacaggatgagaggcctggaccccagcacgccagcccaagtgatc
gctcccagcgagacgccgtcaagcagctctgtagtaaagaagagaagaaaaaggaggaga
aagtcacagctggacagcctgaagagagatgacaacatgaacacatctgaggatgaggac
atgttccccatcgagatgagctcggatgaggccatggagctgctggagagcagcagaact
cttcctaatgatatacctccattccaagatgatattcctgaggaaaacctctccctggct
gtgatttaccctcagtcagcctcataccctaattcggatagagagtggtcacccactccc
agtccttccggttcccgaccttcaacacctaaaagtgattcagaattggtcagcaagtcc
acggaaaggacagggcagaagaacccagaaatgctttggctgtggggagagctgccgcag
gctgctaagtcttcttctccacacaagatgaaagagtccagcccattgagcagtagaaaa
atttgtgataaaagtcactttcaggccattcacagcgaatcttcagacacttttagtgac
caatcgccaactctggtcggtggggcacttttggaccagaacaagcctcagacagaaatg
cagtttgtgaatgaagaagacctggagaccttaggagcagcagcgccactcttgcccatg
atcgaggagctcaaacccccctctgccagtgtagtccagacagcaaacaagacggattct
ccttccaggaaaagagataaacgaagccgacatcttggtgctgacggcgtctacttggat
gacctcacagacatggatcctgaagtggcggccctgtattttcccaaaaacggagatcct
tccggactcgcaaaacatgcaagcgacaacggagcccggtcagccaaccagtccccgcag
tcggtgggcagctcgggcgtggacagtggcgtggagagcacctcggacgggctgagggac
ctcccttccatcgccatctccctctgcgggggcctcagcgaccaccgggagatcacgaaa
gatgcattcctggagcaagctgtgtcatatcaacagtttgtggacaaccccgctattatc
gatgaccccaatctcgtggtaaagattgggagtaaatattataactggacaacagcagca
cccctcctcctggcaatgcaggccttccagaaacctttgccaaaggccactgtggaatct
atcatgagggataaaatgcccaaaaagggaggaagatggtggttttcatggaggggaaga
aacaccacaatcaaggaggaaagtaagccagagcagtgcttggctggcaaggcccatagc
accggagagcaaccgccgcagctcagcttggccaccagggtaaagcatgaatcatcctcc
agtgatgaggagcgcgcagctgccaagccatcaaacgcaggccacctccctcttctgcct
aatgtcagctacaagaagactctccggctgacttccgagcagcttaaaagcttgaagttg
aagaatggccccaacgacgtggttttcagtgtcaccacgcagtaccaaggcacgtgccgc
tgtgagggcaccatctatctgtggaactgggatgataaagtcatcatttctgatattgat
gggacaattaccagatcagatactcttggccacattttgcccacccttgggaaggattgg
acccatcagggcatcgctaagctgtaccataaagtgagccagaatggatataaatttctc
tactgttctgcccgtgccatcgggatggcggacatgacgcggggctacctgcactgggtc
aacgagaggggcacggtgctgccccaggggcccctgctgctgagtcccagcagcctcttc
tctgccctgcacagagaagtgattgaaaagaagccagaaaagtttaaagtccagtgtttg
acagacatcaaaaacctgtttttccccaacacagaacccttttatgctgcttttggaaac
cgaccagctgatgtgtattcatacaagcaagtaggagtgtctttgaatagaatatttacc
gtcaaccctaaaggagagctggtacaggaacatgcaaagaccaacatctcttcgtatgtg
agactctgtgaagtagtcgaccacgttttcccgttgctgaaaagaagccattcttcagac
tttccctgttcggataccttcagtaacttcaccttttggagagagccactgccacctttt
gaaaaccaggacattcattctgcctcagcgtaa

DBGET integrated database retrieval system