KEGG   Homo sapiens (human): 23179Help
Entry
23179             CDS       T01001                                 

Gene name
RGL1, RGL
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator like 1
  KO
K17635  ral guanine nucleotide dissociation stimulator-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    23179 (RGL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA Dehyd-heme_bind DUF5643
Motif
Other DBs
NCBI-GeneID: 23179
NCBI-ProteinID: NP_001284600
OMIM: 605667
HGNC: 30281
Ensembl: ENSG00000143344
Vega: OTTHUMG00000035328
Pharos: Q9NZL6(Tbio)
UniProt: Q9NZL6
Position
1q25.3
AA seq 768 aa AA seqDB search
MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
TSPNCEEDGSQSSSESKMVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLDYLTRMMP
GSDPERRAQNLLEQFQKQEVETDNGLPNTISFSLEEEEELEGGESAEFTCFSEDLVAEQL
TYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTILGGKEL
KTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEE
LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF
QRQQLLTEEESYALSCEIEAAADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPK
STASGSSGESMDSVSVSSCESNHSEAEEGSITPMDTPDEPQKKLSESSSSCSSIHSMDTN
SSGMSSLINPLSSPPSCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKNSMEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctttggcaagctaaaatgagctcgattcaggactggggtgaagaggtagag
gaaggagctgtttaccatgtcaccctcaaaagagtccagattcaacaggctgccaataaa
ggagcaagatggctaggggttgaaggggaccagctgcctccaggacacacagtcagtcaa
tatgaaacctgtaagatcaggaccataaaagctggcaccttggagaagcttgtggagaac
ctgctgacagcttttggggacaatgactttacctatatcagcatctttctttcaacgtac
agaggctttgcctccactaaagaagtgctggaactactgctggacaggtatggaaacctg
acaagcccaaactgtgaagaagatggaagccaaagttcatcagagtccaaaatggtgatc
aggaatgcaatcgcttccatactaagggcctggcttgaccagtgtgcagaagacttccga
gagccccctcacttcccttgcttacagaaactgctggattatctcacacggatgatgccg
ggctctgacccagaaagaagagcacaaaatcttcttgagcagtttcagaagcaagaagtg
gaaactgacaatgggcttcccaacacgatctccttcagcctggaagaggaagaggaactg
gagggtggagagtcagcagaattcacgtgcttctcagaagatctcgtggcagagcagctg
acctacatggatgcacaactcttcaagaaagtagtgcctcaccactgcctgggctgcatt
tggtctcgaagggataagaaggaaaacaaacatttggctcctacgatccgtgccaccatc
tctcagtttaataccctcaccaaatgtgttgtcagcaccatcctggggggcaaagaactc
aaaactcagcagagagccaaaatcattgagaagtggatcaacatcgctcatgaatgtaga
ctcctgaagaatttttcctccttgagggccatcgtttcggcactgcagtctaattccatc
tatcggttaaaaaagacttgggctgccgtcccaagggaccgaatgctgatgtttgaagaa
ctttcagatatcttctcagaccataataaccatttgaccagccgagaactactgatgaag
gaaggaacctcaaaatttgcaaacctggacagcagtgtgaaagaaaaccagaagcgtacc
cagaggcggctgcagctccagaaggacatgggtgtgatgcagggaactgtgccctacctg
ggcaccttcctgactgacctgaccatgcttgacactgcccttcaggactacatcgagggt
ggactgataaactttgagaaaaggagaagggaatttgaagtgattgcccagataaagctc
ttacagtctgcctgcaacagctattgcatgaccccagaccaaaagttcatccagtggttc
cagaggcagcagctcctgacagaggaggagagctatgccctgtcatgtgagattgaagca
gctgctgacgccagcaccacctcgcccaagcctcggaagagcatggtgaagagactcagc
ctactgtttctagggtctgacatgatcaccagtcccactcccaccaaagagcagcccaag
tccactgccagcgggagctctggtgaaagcatggactctgtcagcgtgtcatcctgcgag
tcgaaccactcagaggctgaggagggctccattactcccatggacacccctgatgagcct
caaaaaaagctctctgagtcctcctcatcctgttcttctatccattccatggacacaaat
tcctcagggatgtcttccttaatcaaccccctctcctcccctccgtcctgcaacaacaac
cccaaaatccacaagcgctctgtctcggtgacgtccattacctcgactgtgctgcctcct
gtttacaaccaacagaatgaagacacctgcataatccgcatcagtgtggaagacaataac
ggcaacatgtacaagagcatcatgttgacgagccaggataaaacccccgctgtgatccag
agagccatgctgaagcacaatctggactcagaccccgccgaggagtacgagctggtgcag
gtcatctcggaggacaaagaacttgtgattccagactcagcaaatgtcttttatgccatg
aacagccaagtgaactttgacttcattttgcgcaaaaagaactccatggaagaacaagtg
aaactgcgtagccggaccagcttgacgttgcccaggacagctaaacggggctgctggagt
aacagacacagcaaaatcaccctctga

DBGET integrated database retrieval system