KEGG   Homo sapiens (human): 23187Help
Entry
23187             CDS       T01001                                 

Gene name
PHLDB1, LL5A
Definition
(RefSeq) pleckstrin homology like domain family B member 1
  KO
K23794   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_8 PH_11 PH_3 WD40_alt FHA
Motif
Other DBs
NCBI-GeneID: 23187
NCBI-ProteinID: NP_001138230
OMIM: 612834
HGNC: 23697
Ensembl: ENSG00000019144
Vega: OTTHUMG00000166341
Pharos: Q86UU1(Tbio)
UniProt: Q86UU1 A0A024R3H6 Q8NC75 Q6ZUD6
Position
11q23.3
AA seq 1377 aa AA seqDB search
MDALNRNQIGPGCQTQTMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHTPQTATRGP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQ
SRPSGARSESPRLSRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPRLGGQLPVVA
ISLSEYPASGALSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGSERVLTTSP
SRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPTRTTPDP
KLNREVAESPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPHKGSFSGRLSP
AYSLGSLTGASPCQSPCVQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQER
LREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGRRPSRGLAGA
SGRSSEEPGVATQRLWESMERSDEENLKEECSSTESTQQEHEDAPSTKLQGEVLALEEER
AQVLGHVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQLQEKL
VALETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAELLRS
IAKRKERLAILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGG
RPFPKTTSTLKEMEKLLLPAVDLEQWYQELMAGLGTGPAAASPHSSPPPLPAKASRQLQV
YRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLPR
NLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPAGP
SGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSA
SGLDMGKIEEMEKMLKEAHAEKNRLMESREREMELRRQALEEERRRREQVERRLQSESAR
RQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCR
GYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAK
KRFFRFTMVTESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atggacgctctcaataggaaccaaataggccctggatgccagacccagaccatggtgcag
aaaggacccttggacctgatcgagacaggcaaagggctgaaagtgcaaacggacaaaccc
cacctggtgagcctgggcagtgggcgactcagcacagccatcaccctcctgccgctggag
gaagggaggacggtgattggctctgcagccagagacatctcactacagggcccaggcctg
gctccagagcactgctacatcgagaacctgcggggcaccctcaccctctacccctgtggc
aatgcctgcactattgatgggctccctgtccggcagcctacccggctcactcagggctgc
atgttgtgcctgggtcagtccaccttccttcgctttaaccacccggctgaagccaagtgg
atgaaaagcatgattccagcagggggccgagcccctgggcccccctacagccctgttcct
gcagaatcagaaagtctggtaaatgggaaccacaccccacagactgcaacacggggaccc
tctgcctgtgccagccacagttccctggtgagctctattgagaaggacctgcaagagatc
atggactcactggtgctagaggagcctggagctgctggcaagaagcctgccgcaacctct
ccactgtcaccgatggctaatggtgggcgctacctgctgtctcccccaaccagccccggc
gccatgtctgtgggctccagctatgagaacacctctccagccttctctccactctcttca
ccagccagcagtggaagctgtgccagtcactcacccagtgggcaagagccaggaccttct
gtgcccccgctggtacctgcccgttcctccagctaccatctggccctacagcccccacag
tcccgcccaagtggtgctcgctccgagagtcctcggctgagcaggaaagggggccatgag
aggcctcccagccctggcctccggggtctgctgacagacagccctgcagctactgtcttg
gcggaggcccggagagccactgagagcccccggctgggtgggcagctgcctgtggtggcc
atcagcctgagtgaatacccagcttctggtgctctcagtcaacccaccagcattcctggc
agccccaagtttcagcctccagtccctgctccccgaaacaagattggcacactccaggac
cgccctcccagccctttccgtgagcctccaggcagtgagcgggtgctaacaaccagcccc
tcacgccaactggtgggccgaacattttcagatgggttagccacccgtaccctgcagcct
cctgagagtccccgcctgggccggcggggcctggacagtatgcgagaactacccccctta
agtccatctctgtcccggcgagctctctccccgctgcccacccggaccaccccagatccc
aagctaaacagggaagtggcagagagtcctcggccccggcgctgggcagcccatggggct
tcaccagaggacttctccctgacgctgggggcacggggccgtaggacacggagcccctca
cccacactgggtgagtctctggcaccccacaagggcagcttcagtggcaggctgagccca
gcctacagtctgggctctcttactggggcttcaccctgccagagtccctgtgtccagagg
aagctctccagcggggacttgcgggtgcctgtcacaagggagcggaaaaatagcatcaca
gagatcagtgacaatgaggacgacctcctggagtaccaccggcgacagcgccaagagcgg
ctccgggagcaggagatggagaggctggaacgccagcgcctggagaccatcctgaacctg
tgtgccgaatacagccgggctgatgggggacctgaggctggggagcttcccagcattggg
gaggccaccgcagcattggcactggcaggccggaggccctcacgaggccttgcaggggcc
tctgggcggagcagcgaggagcctggcgttgccacccaacgcctatgggagagtatggag
cgctcagatgaggaaaatctcaaggaggagtgcagcagcactgagagcacccagcaggag
cacgaagatgcacctagcaccaagctccagggagaggtgctagccctggaagaagagcgg
gctcaggtgctggggcacgtggagcagctcaaggtccgtgtgaaggagctagagcagcag
ctgcaggagtcagcccgagaggccgaaatggagcgggcactgctgcagggagagagggag
gcagagcgggcactgctgcagaaggagcagaaggcagtggatcagctgcaggagaagctg
gtggccttggagacaggcatccagaaggagagggacaaggaggcagaggccctggagact
gagacaaagctctttgaggacttggagttccagcagttggagcgggagagccgcgtggag
gaggagcgcgagctggccggccaggggctgctccggagcaaggctgagctgctccgcagc
atcgccaagaggaaggagcgcctggccatcctggacagtcaggctgggcagatccgggct
caggccgtgcaggaatcagaacgcctggcccgggacaagaatgcctccttacagctgctg
caaaaggagaaggagaagctgactgtgctggaaaggagataccactcactcacagggggc
aggcctttcccgaagaccacatcgaccctcaaagagatggagaagctgctgctccctgct
gtagacttagagcagtggtaccaggagctgatggccgggctggggactggccccgctgca
gcctcccctcactcttctcccccgcctctgcccgccaaagcttcccgtcagctgcaggtt
taccgctccaagatggatggcgaggccaccagcccccttccccggacccgcagcggcccc
ctcccctcctcctctggctcttcctcctcctcctcccagctcagcgtggctaccctgggg
cgtagcccctccccaaagagcgctctactcacccagaatggcacgggcagccttcctcgc
aacctggcagccacactgcaggacatcgagaccaagcgccaactagctctgcagcagaag
ggacaacaagtgattgaagagcagcggcggcgactggctgagctgaagcagaaagcggca
gctgaggcacagtgccagtgggatgcccttcacggggcagcacccttcccagcgggcccc
tcgggcttcccccctctcatgcaccactctatcctacaccacctgcctgcggggcgggag
cgtggggaggagggtgagcacgcctatgatacgctgagtctggagagctctgacagcatg
gagaccagcatctccaccgggggcaactcggcctgctcccctgacaacatgtccagcgcg
agtggtctggacatggggaagatcgaggagatggagaagatgctgaaagaggctcatgca
gagaagaaccggctcatggagtcgagggagcgggagatggagctgcggcggcaggccctg
gaggaggagcggcggaggcgtgagcaggtagaacggaggctgcagagtgagagtgcccgg
aggcagcagctggtcgagaaggaggtcaagatgcgggagaaacaattttcccaggcacga
cccctgacccgctacctgccaatccggaaggaggactttgacctgaagacacatattgag
tcatcgggccatggtgttgatacctgcctgcacgtggtgctcagcagcaaggtctgccgt
ggctacttggtcaagatgggcggcaagattaaatcatggaagaagcgctggtttgtcttc
gaccggctcaagcgcaccctttcctattatgtggacaagcatgagacgaagctgaaggga
gtcatctatttccaggccattgaggaagtgtactacgaccacctgcgcagtgcagccaag
aagaggtttttccgcttcactatggtgactgagagcccgaacccagccctcaccttctgc
gtaaagacccatgaccggctgtactacatggtggccccatctgcagaggccatgcgtatc
tggatggatgtcattgtcacaggggctgagggctacactcagttcatgaactaa

DBGET integrated database retrieval system