KEGG   Homo sapiens (human): 2319Help
Entry
2319              CDS       T01001                                 

Gene name
FLOT2, ECS-1, ECS1, ESA, ESA1, M17S1
Definition
(RefSeq) flotillin 2
  KO
K07192  flotillin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2319 (FLOT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2319 (FLOT2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    2319 (FLOT2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2319 (FLOT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    2319 (FLOT2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    2319 (FLOT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2319 (FLOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Flot
Motif
Other DBs
NCBI-GeneID: 2319
NCBI-ProteinID: NP_004466
OMIM: 131560
HGNC: 3758
Ensembl: ENSG00000132589
Vega: OTTHUMG00000132674
Pharos: Q14254(Tbio)
UniProt: Q14254 A0A024QZ62 Q9BTI6
Position
17q11.2
AA seq 428 aa AA seqDB search
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVE
TAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTV
EQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDAD
IGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLA
YELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALV
LEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KKATGVQV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggcaattgccacacggtggggcccaacgaggcgctggtggtttcagggggctgttgt
ggttccgactataaacagtacgtgtttggcggctgggcctgggcctggtggtgtatctcc
gacactcagaggatttccctagagattatgacgttgcagccccgctgcgaggacgtagag
acggccgagggggtagctttaactgtgacgggtgtcgcccaggtgaagatcatgacggag
aaggaactcctggccgtggcttgtgagcagtttctgggtaagaatgtgcaggacatcaaa
aacgtcgtcctgcagaccctggagggacatctgcgctccatcctcgggaccctgacagtg
gagcagatttatcaggaccgggaccagtttgccaagctggtgcgggaggtggcagcccct
gatgttggccgcatgggcattgagatcctcagcttcaccatcaaggacgtgtatgacaaa
gtggactatctgagctccctgggcaagacgcagactgccgtggtgcagagagatgctgac
attggcgtggccgaggctgaacgggacgcaggcatccgggaagctgagtgcaagaaggag
atgctggatgtgaagttcatggcagacaccaagattgctgactctaagcgagccttcgag
ctgcaaaagtcagccttcagtgaggaggttaacatcaagacagctgaggcccagttggcc
tatgagctgcagggggcccgtgaacagcagaagatccggcaggaagagattgagattgag
gttgtgcagcgcaagaaacagattgccgtggaggcacaggagatcctgcgtacggacaag
gagctcatcgctacagtgcgccggcctgccgaggccgaggcccaccgcatccagcagatt
gccgagggtgaaaaggtgaagcaggtcctcttggcacaggcagaggctgagaagatccgc
aaaatcggggaggcggaagcggcagtcatcgaggcgatgggcaaggcagaggctgagcgg
atgaagctcaaggcagaagcctaccagaaatacggggatgcagccaagatggccttggtg
ctagaggccctgccccagattgctgccaaaatcgctgccccacttaccaaggtcgatgag
attgtggtcctcagtggagacaacagtaaggtcacatcagaagtgaaccgactgctggcc
gagctgcctgcctctgtgcatgccctcacaggcgtggacctgtctaagatacccctgatc
aagaaggccactggtgtgcaggtgtga

DBGET integrated database retrieval system