KEGG   Homo sapiens (human): 23190
Entry
23190             CDS       T01001                                 
Symbol
UBXN4, UBXD2, UBXDC1, erasin
Name
(RefSeq) UBX domain protein 4
  KO
K24348  UBX domain-containing protein 1/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23190 (UBXN4)
SSDB
Motif
Pfam: UBX
Other DBs
NCBI-GeneID: 23190
NCBI-ProteinID: NP_055422
OMIM: 611216
HGNC: 14860
Ensembl: ENSG00000144224
Pharos: Q92575(Tdark)
UniProt: Q92575
Structure
Position
2:135741855..135785056
AA seq 508 aa
MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETS
VANGSQSESSVSTPSASFEPNNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSS
QEPSGCSDQRPAEDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLA
KQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNF
SLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKK
EGKIYRLRTQDDGEDENNTWNGNSTQQM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgctgtggttccagggcgccattccggccgccatcgcgacggccaaaaggagcggcgcg
gtcttcgtggtgttcgtggcaggtgatgatgaacagtctacacagatggctgcaagttgg
gaagatgataaagttacagaagcatcttcaaacagttttgttgctattaaaatcgatacc
aaaagtgaagcctgcctacagttttcacaaatctatcctgtagtgtgtgttccatccagt
ttctttattggagacagtggaattcccttggaagtaatagcaggaagtgtttctgcagat
gaacttgttacaagaattcacaaggtccgacagatgcatttgctaaaaagtgaaacatca
gtagcaaatggcagtcagtcagaaagttcagtgtctactccatctgcgtcatttgaacct
aacaacacttgtgaaaactctcagtccagaaatgcagagctttgtgagataccacccact
tctgatacaaagtcagatactgcaacaggaggagaaagtgcaggccatgccacttcctct
caggagcctagtggatgctcagatcagagacctgcagaggacctcaacatccgagtggaa
agactaacaaaaaaacttgaagaaaggagagaagagaaaagaaaagaggaagaacagaga
gaaattaagaaggaaattgagaggagaaaaactggaaaagaaatgttggattataaaaga
aaacaagaagaagaattaacaaaaagaatgctggaggaaagaaacagagagaaagcagaa
gatagggcagctcgagaacgtataaaacagcagattgcattggaccgtgcagagagagct
gctcgttttgcaaagacaaaggaagaagtagaggctgccaaagctgctgccttgctagca
aaacaggcagaaatggaagtcaagagggaatcttatgcaagagaaagaagcactgttgca
agaattcaattccgtcttcctgatggttcttcctttacaaatcagttcccttctgatgct
cctctagaagaggcaaggcagtttgctgcacagactgttggcaacacttacggtaatttt
tcgttagcaaccatgtttcccaggagggaatttaccaaagaagattataaaaagaagtta
ctggatttggaacttgccccaagcgcttcggtggtactgttgccagcaggaagaccaact
gcatccattgtacactcttccagcggagacatttggaccttgttgggaacagtgctttat
ccattccttgccatctggagattaattagcaatttcttgtttagtaatccgcctcccaca
cagacttcagtgagagtaacatcgtcagaacccccaaaccctgcatcatctagcaaatca
gaaaaaagggaaccagtgagaaaaagagtgctggaaaaacgtggagacgactttaaaaag
gaggggaaaatttatagattaaggactcaagatgatggtgaagatgaaaacaacacttgg
aatggaaattccactcaacagatgtag

DBGET integrated database retrieval system