KEGG   Homo sapiens (human): 23193
Entry
23193             CDS       T01001                                 

Symbol
GANAB, G2AN, GIIA, GLUII, PKD3
Name
(RefSeq) glucosidase II alpha subunit
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Disease
H00542  Polycystic kidney disease
H01728  Potter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    23193 (GANAB)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23193 (GANAB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     23193 (GANAB)
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 23193
NCBI-ProteinID: NP_938148
OMIM: 104160
HGNC: 4138
Ensembl: ENSG00000089597
Vega: OTTHUMG00000167696
Pharos: Q14697(Tchem)
UniProt: Q14697 V9HWJ0
Position
11q12.3
AA seq 944 aa
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggcggcggtagcggcagtggcggcgcgtaggaggcggtcttgggcgtctttggtactg
gcttttttaggggtctgcctggggattacccttgctgtggatagaagcaactttaagacc
tgtgaagagagttctttctgcaagcgacagagaagcatacggccaggcctctctccatac
cgagccttgctggactctctacagcttggtcctgattccctcacggtccatctgatccat
gaggtcaccaaggtgttgctggtgctagagcttcaggggcttcaaaagaacatgactcgg
ttcaggattgatgagctggagcctcggcgaccccgataccgtgtaccagatgttttggtg
gctgatccaccaatagcccggctttctgtctctggtcgtgatgagaacagtgtggagtta
accatggctgagggaccctacaagatcatcttgacagcacggccattccgccttgaccta
ctagaggaccgaagtcttttgcttagtgtcaatgcccgaggactcttggagtttgagcat
cagagggcccctagggtctcgcaaggatcaaaagacccagctgagggcgatggggcccag
cctgaggaaacacccagggatggcgacaagccagaggagactcaggggaaggcagagaaa
gatgagccaggagcctgggaggagacattcaaaactcactctgacagcaagccgtatggc
cccatgtctgtgggtttggacttctctctgccaggcatggagcatgtctatgggatccct
gagcatgcagacaacctgaggctgaaggtcactgagggtggggagccatatcgcctctac
aatttggatgtgttccagtatgagctgtacaacccaatggccttgtatgggtctgtgcct
gtgctcctggcacacaaccctcatcgcgacttgggcatcttctggctcaatgctgcagag
acctgggttgatatatcttccaacactgccgggaagaccctgtttgggaagatgatggac
tacctgcagggctctggggagaccccacagacagatgttcgctggatgtcagagactggc
atcattgacgtcttcctgctgctggggccctccatctctgatgttttccggcaatatgct
agtctcacaggaacccaggcgttgcccccactcttctccctcggctaccaccagagccgt
tggaactaccgggacgaggctgatgtgctggaagtggatcagggctttgatgatcacaac
ctgccctgtgatgtcatctggctagacattgaacatgctgatggcaagcggtatttcacc
tgggaccccagtcgcttccctcagccccgcaccatgcttgagcgcttggcttctaagagg
cggaagctggtggccatcgtagacccccacatcaaggtggactccggctaccgagttcac
gaggagctgcggaacctggggctgtatgttaaaacccgggatggctctgactatgagggc
tggtgctggccaggctcagctggttaccctgacttcactaatcccacgatgagggcctgg
tgggctaacatgttcagctatgacaattatgagggctcagctcccaacctctttgtctgg
aatgacatgaacgaaccatctgtgttcaatggtcctgaggtcaccatgctcaaggatgcc
cagcattatgggggctgggagcaccgggatgtgcataacatctatggcctttatgtgcac
atggcgactgctgatgggctgagacagcgctctgggggcatggaacgcccctttgtcctg
gccagggccttcttcgctggctcccagcgctttggagccgtgtggacaggggacaacact
gccgagtgggaccatttgaagatctctattcctatgtgtctcagcttggggctggtggga
ctttccttctgtggggcggatgtgggtggcttcttcaaaaacccagagccagagctgctt
gtgcgctggtaccagatgggtgcttaccagccattcttccgggcacatgcccacttggac
actgggcgacgagagccatggctgttaccatctcagcacaatgatataatccgagatgcc
ttgggccagcgatattctttgctgcccttctggtacaccctcttatatcaggcccatcgg
gaaggcattcctgtcatgaggcccctgtgggtgcagtaccctcaggatgtgactaccttc
aatatagatgatcagtacttgcttggggatgcgttgctggttcaccctgtatcagactct
ggagcccatggtgtccaggtctatctgcctggccaaggggaggtgtggtatgacattcaa
agctaccagaagcatcatggtccccagaccctgtacctgcctgtaactctaagcagtatc
cctgtgttccagcgtggagggacaatcgtgcctcgatggatgcgagtgcggcggtcttca
gaatgtatgaaggatgaccccatcactctctttgttgcacttagccctcagggtacagct
caaggagagctctttctggatgatgggcacacgttcaactatcagactcgccaagagttc
ctgctgcgtcgattctcattctctggcaacacccttgtctccagctcagcagaccctgaa
ggacactttgagacaccaatctggattgagcgggtggtgataataggggctggaaagcca
gcagctgtggtactccagacaaaaggatctccagaaagccgcctgtccttccagcatgac
cctgagacctctgtgttggtcctgcgcaagcctggcatcaatgtggcatctgattggagt
attcacctgcgataa

KEGG   Homo sapiens (human): 5589
Entry
5589              CDS       T01001                                 

Symbol
PRKCSH, AGE-R2, G19P1, GIIB, PCLD, PCLD1, PKCSH, PLD1, VASAP-60
Name
(RefSeq) protein kinase C substrate 80K-H
  KO
K08288  protein kinase C substrate 80K-H
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00545  Polycystic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5589 (PRKCSH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    5589 (PRKCSH)
Lectins [BR:hsa04091]
 P-type lectins
  5589 (PRKCSH)
SSDB
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_6 EF-hand_1 Ldl_recept_a EF-hand_7 YjhX_toxin
Other DBs
NCBI-GeneID: 5589
NCBI-ProteinID: NP_002734
OMIM: 177060
HGNC: 9411
Ensembl: ENSG00000130175
Vega: OTTHUMG00000182029
Pharos: P14314(Tbio)
UniProt: P14314
Position
19p13.2
AA seq 528 aa
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASPAEEDKMPPYD
EQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTT
NEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgctgttgccgctgctgctgctgctacccatgtgctgggccgtggaggtcaagaggccc
cggggcgtctccctcaccaatcatcacttctacgatgagtccaagcctttcacctgcctg
gacggttcggccaccatcccatttgatcaggtcaacgatgactattgcgactgcaaagat
ggctctgacgagccaggcacggctgcctgtcctaatggcagcttccactgcaccaacact
ggctataagcccctgtatatcccctccaaccgggtcaacgatggtgtttgtgactgctgc
gatggaacagacgagtacaacagcggcgtcatctgtgagaacacctgcaaagagaagggc
cgtaaggagagagagtccctgcagcagatggccgaggtcacccgcgaagggttccgtctg
aagaagatccttattgaggactggaagaaggcacgggaggagaagcagaaaaagctcatt
gagctacaggctgggaagaagtctctggaagaccaggtggagatgctgcggacagtgaag
gaggaagctgagaagccagagagagaggccaaagagcagcaccagaagctgtgggaagag
cagctggctgctgccaaggcccaacaggagcaggagctggcggctgatgccttcaaggag
ctggatgatgacatggacgggacggtctcggtgactgagctgcagactcacccggagctg
gacacagatggggatggggcgttgtcagaagcggaagctcaggccctcctcagtggggac
acacagacagacgccacctctttctacgaccgcgtctgggccgccatcagggacaagtac
cggtccgaggcactgcccaccgaccttccagcaccttctgcccctgacttgacggagccc
aaggaggagcagccgccagtgccctcgtcgcccacagaggaggaggaggaggaggaggag
gaggaggaagaagaggctgaagaagaggaggaggaggaggattccgaggaggccccaccg
ccactgtcacccccgcagccggccagccctgctgaggaagacaaaatgccgccctacgac
gagcagacgcaggccttcatcgatgctgcccaggaggcccgcaacaagttcgaggaggcc
gagcggtcgctgaaggacatggaggagtccatcaggaacctggagcaagagatttctttt
gactttggccccaacggggagtttgcttacctgtacagccagtgctacgagctcaccacc
aacgaatacgtctaccgcctctgccccttcaagcttgtctcgcagaaacccaaactcggg
ggctctcccaccagccttggcacctggggctcatggattggccccgaccacgacaagttc
agtgccatgaagtatgagcaaggcacgggctgctggcagggccccaaccgctccaccacc
gtgcgcctcctgtgcgggaaagagaccatggtgaccagcaccacagagcccagtcgctgc
gagtacctcatggagctgatgacgccagccgcctgcccggagccaccgcctgaagcaccc
accgaagacgaccatgacgagctctag

DBGET integrated database retrieval system