KEGG   Homo sapiens (human): 23194Help
Entry
23194             CDS       T01001                                 

Gene name
FBXL7, FBL6, FBL7
Definition
(RefSeq) F-box and leucine rich repeat protein 7
  KO
K10273  F-box and leucine-rich repeat protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23194 (FBXL7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     23194 (FBXL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 F-box-like LRR_4 F-box PTE
Motif
Other DBs
NCBI-GeneID: 23194
NCBI-ProteinID: NP_036436
OMIM: 605656
HGNC: 13604
Ensembl: ENSG00000183580
Vega: OTTHUMG00000161798
Pharos: Q9UJT9(Tbio)
UniProt: Q9UJT9
Position
5p15.1
AA seq 491 aa AA seqDB search
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgaacaatggcaaacagtacggcagtgagggcaaaggcagctcgagcatctca
tctgacgtgagttcaagtacagatcacacgcccactaaagcccagaagaatgtggctacc
agcgaagactccgacctgagcatgcgcacactgagcacgcccagcccagccctgatatgt
ccaccgaatctcccaggatttcagaatggaaggggctcgtccacctcctcgtcctccatc
accggggagacggtggccatggtgcactccccgcccccgacccgcctcacacacccgctc
atccggctcgcctccagaccccagaaggagcaggccagcatagaccggctcccggaccac
tccatggtgcagatcttctccttcctgcccaccaaccagctgtgccgctgcgcgcgagtg
tgccgccgctggtacaacctggcctgggacccgcggctctggaggactatccgcctgacg
ggcgagaccatcaacgtggaccgcgccctcaaggtgctgacccgcagactctgccaggac
acccccaacgtgtgtctcatgctggaaaccgtaactgtcagtggctgcaggcggctcaca
gaccgagggctgtacaccatcgcccagtgctgccccgaactgaggcgactggaagtctca
ggctgttacaatatctccaacgaggccgtctttgatgtggtgtccctctgccctaatctg
gagcacctggatgtgtcaggatgctccaaagtgacctgcatcagcttgacccgggaggcc
tccattaaactgtcacccttgcatggcaaacagatttccatccgctacctggacatgacg
gactgcttcgtgctggaggacgaaggcctgcacaccatcgcggcgcactgcacgcagctc
acccacctctacctgcgccgctgcgtccgcctgaccgacgaaggcctgcgctacctggtg
atctactgcgcctccatcaaggagctgagcgtcagcgactgccgcttcgtcagcgacttc
ggcctgcgggagatcgccaagctggagtcccgcctgcggtacctgagcatcgcgcactgc
ggccgggtcaccgacgtgggcatccgctacgtggccaagtactgcagcaagctgcgctac
ctcaacgcgaggggctgcgagggcatcacggaccacggtgtggagtacctcgccaagaac
tgcaccaaactcaaatccctggatatcggcaaatgccctttggtatccgacacgggcctg
gagtgcctggccctgaactgcttcaacctcaagcggctcagcctcaagtcctgcgagagc
atcaccggccagggcttgcagatcgtggccgccaactgctttgacctccagacgctgaat
gtccaggactgcgaggtctccgtggaggccctgcgctttgtcaaacgccactgcaagcgc
tgcgtcatcgagcacaccaacccggctttcttctga

DBGET integrated database retrieval system