KEGG   Homo sapiens (human): 23198Help
Entry
23198             CDS       T01001                                 

Gene name
PSME4, PA200
Definition
(RefSeq) proteasome activator subunit 4
  KO
K06699  proteasome activator subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    23198 (PSME4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    23198 (PSME4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA200
    23198 (PSME4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BLM10_mid DUF3437 HEAT HEAT_2 Filament
Motif
Other DBs
NCBI-GeneID: 23198
NCBI-ProteinID: NP_055429
OMIM: 607705
HGNC: 20635
Ensembl: ENSG00000068878
Vega: OTTHUMG00000151852
Pharos: Q14997(Tdark)
UniProt: Q14997
Structure
PDB: 

Position
2p16.2
AA seq 1843 aa AA seqDB search
MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLG
RAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFA
RLLINLLKKKELLSRADLELPWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSC
RPYFPADATAEMLEEWRPLMCPFDVTMQKAITYFEIFLPTSLPPELHHKGFKLWFDELIG
LWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPR
FLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRL
PNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQA
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTH
MLPLLMRALPGVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSAT
AEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKE
IFMVALQKVFNFSTSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCCSVITQLTMN
DDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVKILQRTLHLTCKQGYTLSCNL
LHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWHVPSSEEVSFA
FYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV
PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDL
LQFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEY
KKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVT
QQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLA
EKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILLSPEKIKEGIKRQQEKNADAL
RNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVV
RKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK
KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVE
QLITFLSLEDRKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVA
EIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKL
HWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKN
VRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEKLKPLMDVDEEIQNHVMEENG
IGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVENDNSYDELKR
DAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE
DAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKR
KRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEM
TVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
NT seq 5532 nt NT seq  +upstreamnt  +downstreamnt
atggagccggccgagcgggcgggagtcggagagcccccggagccgggcgggcgtcccgag
ccgggcccgcggggcttcgtcccgcagaaggagatcgtctacaacaagctgctgccctac
gcggagcggctagacgccgagtccgacttgcagctggcccagatcaaatgcaacctgggc
cgggccgtgcagctccaagagctgtggcccgggggcctcttctggaccaggaaactctcc
acatatattcgactttatgggagaaaatttagcaaagaagatcatgttctttttattaag
ttattgtatgagctggtatcaattccaaaactggaaatcagcatgatgcagggatttgcc
cgccttttgatcaacttgttaaagaaaaaggaacttctttcaagagctgatttggagtta
ccctggagaccactttatgacatggtagaaagaatattatattccaagacagagcaccta
ggattaaattggtttcctaattctgtagaaaatattctcaaaacactcgtgaaaagctgc
cgaccatattttccagcagatgccaccgctgagatgctagaagaatggcgacctttaatg
tgcccttttgatgtaaccatgcaaaaggccatcacttattttgaaatatttcttcctacc
tcccttcctccagaacttcatcataaaggttttaaactttggtttgatgaattaattggc
ctttgggtttcagtgcaaaatctcccacaatgggaggggcaactagtaaatctctttgct
cgattggctacagataatatagggtacatagattgggatccatatgtaccaaagatattt
acaagaattctgagaagcttgaacctcccagtgggaagcagtcaagtgttagtcccaaga
tttttaacaaatgcttatgatataggacatgctgtaatatggatcaccgccatgatgggt
ggaccaagtaagctagtgcaaaaacacttagctggtttgtttaacagcatcacatctttt
taccatccttcaaataatgggcgctggctgaacaagttaatgaaactacttcagcggttg
ccaaacagtgttgttagaagattgcatcgtgaaagatacaagaagccctcttggttaact
cctgtgcctgatagccacaagcttactgatcaagatgttacagactttgtacaatgcatt
attcagcctgtcctcttggctatgtttagcaaaaccggtagtctagaagcagcccaggct
ttgcagaatcttgcactcatgagacctgaattggtaataccccctgtacttgaaagaaca
tatcctgcattagagacattaacagaacctcaccagctcacagctactttaagttgtgta
attggagtagcccgcagtttggtatcaggaggcagatggtttcctgaaggtcctacacat
atgctacctctgttgatgagagcattgcctggggtggatccaaatgactttagtaaatgc
atgatcacattccagttcatagcaacattttctactctggtgcctttagtagattgttca
tctgtactacaagaaagaaatgacctcacagaagtggaacgagaactttgttcagccaca
gctgaatttgaggatttcgtcttacagtttatggacagatgttttggacttatagaaagt
agcacattggagcaaacaagagaagagacagaaactgagaaaatgacacacttggagagt
ttggtcgaattaggtctgtcttctacgtttagtacaatcctcacccaatgttccaaagaa
atatttatggtggcccttcagaaggtttttaatttttctacttcacatatatttgaaaca
agagtagcaggtcgcatggtggcagacatgtgccgcgctgctgtaaagtgctgcccagaa
gaatctttgaagctctttgttccccactgctgcagtgttataactcagcttacaatgaat
gatgatgtattaaatgatgaagagctagacaaggaattactatggaatcttcaacttttg
tctgagattactcgagtggatggaaggaagttgcttctttatagggagcagcttgtaaag
attctccaaagaaccctacatttaacctgtaagcagggttacactctgtcttgtaacctt
ttgcatcatcttctccgttctaccacacttatctaccctacagaatactgcagtgtgcca
ggtggctttgacaagcctccttctgaatactttcctatcaaggactggggcaaacccggg
gacttgtggaatctgggaatccagtggcatgttccttcttcagaagaagtgtcttttgcc
ttttatcttttggactcctttcttcagcctgagctcgtcaaactccagcattgtggggat
ggaaaacttgaaatgtctagagatgatattctacagagtctgactatagtgcacaactgt
ttaattggctctggaaacctcctacctccgttgaaaggagagccagttactaacttagta
ccaagtatggtgtccttggaagagacaaagttgtatactggacttgaatatgatctgtct
cgagagaaccaccgagaagtaattgctacagttataaggaaacttcttaaccacatactt
gataattcagaagatgatactaagtcattgtttcttattataaagattattggagacctt
ttacaattccaaggatctcacaagcatgaatttgactcccgatggaaaagcttcaactta
gtaaagaaatcaatggaaaatcggctccatgggaaaaaacaacatatcagagcactgttg
attgatagagtaatgttacagcatgagctacggacactaactgttgagggttgtgaatac
aaaaagatacatcaagatatgatcagagatcttcttcgtttatctacaagttcatacagt
caggtgagaaataaggctcagcaaacattttttgctgccttgggagcatataacttctgt
tgcagagatatcattcccttggttttggagttcttaaggcctgatagacaaggtgttaca
cagcaacaattcaagggtgccttgtactgtctccttggaaatcacagtggtgtgtgcttg
gcaaaccttcatgattgggactgtattgtacagacgtggccagcgattgtttcttcaggg
cttagccaagcaatgtccctggaaaagccatcaatagtgagattgtttgatgatcttgca
gaaaagattcataggcagtatgaaacaattggcttggacttcacaattccaaagtcatgt
gttgaaatagcggaattacttcaacagtcaaaaaacccctctatcaaccagatattgctt
agcccagaaaaaattaaggaaggaattaaacgccaacaggaaaagaatgccgatgcccta
aggaactatgaaaatttggtagacaccttgctagatggtgtggagcaaagaaacctgccc
tggaaatttgaacatataggcattgggcttctgtctctactgctgagagatgaccgagtg
ttgcctcttcgtgccatacggttttttgttgagaatctcaaccatgatgcaattgtagtt
cgaaagatggctatctcagctgttgctggtatccttaaacagctaaaaagaacccacaaa
aagctgaccattaacccctgtgaaatcagtggatgccctaaacccacccaaattattgct
ggtgataggcctgataatcattggttgcattatgacagcaaaactataccaagaactaaa
aaagaatgggagtcaagttgctttgtggaaaaaactcactggggatactacacctggcca
aagaatatggttgtttatgctggtgtggaagagcagcctaagcttggcagaagcagggag
gatatgacagaggcagaacagattatatttgatcatttttctgatcctaaatttgttgag
cagttaattacttttctatcattagaagacagaaaaggaaaagataagtttaatccacga
cgtttttgcctctttaagggtatattcaggaattttgatgatgccttcctgccagttctg
aagccccatttagaacatttggttgcagattcacatgaaagcacccagcgatgtgttgca
gaaattatagctggtttaatcagaggttctaagcactggacatttgaaaaggtggagaag
ctttgggagcttctgtgccctctgcttagaacagcactgtccaatattaccgtagaaact
tataatgactggggagcttgtatagcaacatcctgtgaaagcagagatccccggaaactt
cactggctttttgaactgctgttggaatcaccattgagtggtgaaggaggatcctttgta
gatgcatgtcgactttatgtactacaaggtggccttgcccagcaagaatggagagtgcct
gaactattgcacagactactgaagtacttggaacccaaactcacccaggtttacaaaaat
gtcagagaaagaataggaagtgtgctgacctacatattcatgatagatgtatctttgcca
aataccacaccaaccatatcgcctcatgtccctgagtttactgctcgaattctggagaaa
ttgaaacctctcatggatgtggatgaagaaattcagaaccatgttatggaagaaaatgga
attggtgaagaagatgagcgaactcagggcattaaactcttgaaaaccatattgaaatgg
ctgatggcaagtgcaggaagatccttttctacagcagttacagaacaacttcagcttcta
cctttgtttttcaagattgccccagtggaaaatgacaatagctacgatgaactgaaaaga
gatgcaaagttatgtttatcattaatgtctcaggggttgctttaccctcatcaagtgcct
ttggtacttcaggtgctaaaacaaacagcaagaagcagttcttggcatgcacgatacaca
gtactgacctacctccagaccatggtattttataacctctttattttcctaaacaatgaa
gatgcagttaaagatatcaggtggctggttataagtcttttggaggacgaacaactggag
gttcgagaaatggctgctactaccttaagcggtctgctacagtgtaactttcttaccatg
gacagtcctatgcagattcattttgagcaactttgcaaaacaaaactacctaagaaaaga
aagcgagaccctggttctgtaggagataccattccttctgcagagttggtcaaacgccat
gctggggtgctaggacttggtgcatgtgttctttctagtccttacgatgttcccacctgg
atgccccagctcctcatgaatctcagtgcacatctaaatgatcctcagcctattgagatg
actgtaaaaaaaaccttatccaatttccgaaggactcaccatgacaactggcaggaacat
aaacagcaattcactgatgaccaactgcttgttctcaccgatcttcttgtgtcaccatgc
tattatgcatag

DBGET integrated database retrieval system