KEGG   Homo sapiens (human): 23200
Entry
23200             CDS       T01001                                 
Symbol
ATP11B, ATPIF, ATPIR
Name
(RefSeq) ATPase phospholipid transporting 11B (putative)
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    23200 (ATP11B)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     23200 (ATP11B)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 23200
NCBI-ProteinID: NP_055431
OMIM: 605869
HGNC: 13553
Ensembl: ENSG00000058063
Pharos: Q9Y2G3(Tbio)
UniProt: Q9Y2G3 B4DKX1 B4E3T1
Position
3:182793504..182921629
AA seq 1177 aa
MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLF
EQFRRVANFYFLIIFLVQLMIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHNSDNEVN
GAPVYVVRSGGLVKTRSKNIRVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGE
TNLKTHVAVPETALLQTVANLDTLVAVIECQQPEADLYRFMGRMIITQQMEEIVRPLGPE
SLLLRGARLKNTKEIFGVAVYTGMETKMALNYKSKSQKRSAVEKSMNTFLIIYLVILISE
AVISTILKYTWQAEEKWDEPWYNQKTEHQRNSSKILRFISDFLAFLVLYNFIIPISLYVT
VEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFR
ECSINGMKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETE
LIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYYASSPDEKALVEAAAR
IGIVFIGNSEETMEVKTLGKLERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESS
ILPKCIGGEIEKTRIHVDEFALKGLRTLCIAYRKFTSKEYEEIDKRIFEARTALQQREEK
LAAVFQFIEKDLILLGATAVEDRLQDKVRETIEALRMAGIKVWVLTGDKHETAVSVSLSC
GHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLF
MEVCRNCSAVLCCRMAPLQKAKVIRLIKISPEKPITLAVGDGANDVSMIQEAHVGIGIMG
KEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYC
LFSQQTLYDSVYLTLYNICFTSLPILIYSLLEQHVDPHVLQNKPTLYRDISKNRLLSIKT
FLYWTILGFSHAFIFFFGSYLLIGKDTSLLGNGQMFGNWTFGTLVFTVMVITVTVKMALE
THFWTWINHLVTWGSIIFYFVFSLFYGGILWPFLGSQNMYFVFIQLLSSGSAWFAIILMV
VTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERV
IGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgtggcgctggatccggcagcagctgggttttgacccaccacatcagagtgacacaaga
accatctacgtagccaacaggtttcctcagaatggcctttacacacctcagaaatttata
gataacaggatcatttcatctaagtacactgtgtggaattttgttccaaaaaatttattt
gaacagttcagaagagtggcaaacttttattttcttattatatttttggttcagcttatg
attgatacacctaccagtccagttaccagtggacttccattattctttgtgataacagta
actgccataaagcagggatatgaagattggttacggcataactcagataatgaagtaaat
ggagctcctgtttatgttgttcgaagtggtggccttgtaaaaactagatcaaaaaacatt
cgggtgggtgatattgttcgaatagccaaagatgaaatttttcctgcagacttggtgctt
ctgtcctcagatcgactggatggttcctgtcacgttacaactgctagtttggacggagaa
actaacctgaagacacatgtggcagttccagaaacagcattattacaaacagttgccaat
ttggacactctagtagctgtaatagaatgccagcaaccagaagcagacttatacagattc
atgggacgaatgatcataacccaacaaatggaagaaattgtaagacctctggggccggag
agtctcctgcttcgtggagccagattaaaaaacacaaaagaaatttttggtgttgcggta
tacactggaatggaaactaagatggcattaaattacaagagcaaatcacagaaacgatct
gcagtagaaaagtcaatgaatacatttttgataatttatctagtaattcttatatctgaa
gctgtcatcagcactatcttgaagtatacatggcaagctgaagaaaaatgggatgaacct
tggtataaccaaaaaacagaacatcaaagaaatagcagtaagattctgagatttatttca
gacttccttgcttttttggttctctacaatttcatcattccaatttcattatatgtgaca
gtcgaaatgcagaaatttcttggatcattttttattggctgggatcttgatctgtatcat
gaagaatcagatcagaaagctcaagtcaatacttccgatctgaatgaagagcttggacag
gtagagtacgtgtttacagataaaactggtacactgacagaaaatgagatgcagtttcgg
gaatgttcaattaatggcatgaaataccaagaaattaatggtagacttgtacccgaagga
ccaacaccagactcttcagaaggaaacttatcttatcttagtagtttatcccatcttaac
aacttatcccatcttacaaccagttcctctttcagaaccagtcctgaaaatgaaactgaa
ctaattaaagaacatgatctcttctttaaagcagtcagtctctgtcacactgtacagatt
agcaatgttcaaactgactgcactggtgatggtccctggcaatccaacctggcaccatcg
cagttggagtactatgcatcttcaccagatgaaaaggctctagtagaagctgctgcaagg
attggtattgtgtttattggcaattctgaagaaactatggaggttaaaactcttggaaaa
ctggaacggtacaaactgcttcatattctggaatttgattcagatcgtaggagaatgagt
gtaattgttcaggcaccttcaggtgagaagttattatttgctaaaggagctgagtcatca
attctccctaaatgtataggtggagaaatagaaaaaaccagaattcatgtagatgaattt
gctttgaaagggctaagaactctgtgtatagcatatagaaaatttacatcaaaagagtat
gaggaaatagataaacgcatatttgaagccaggactgccttgcagcagcgggaagagaaa
ttggcagctgttttccagttcatagagaaagacctgatattacttggagccacagcagta
gaagacagactacaagataaagttcgagaaactattgaagcattgagaatggctggtatc
aaagtatgggtacttactggggataaacatgaaacagctgttagtgtgagtttatcatgt
ggccattttcatagaaccatgaacatccttgaacttataaaccagaaatcagacagcgag
tgtgctgaacaattgaggcagcttgccagaagaattacagaggatcatgtgattcagcat
gggctggtagtggatgggaccagcctatctcttgcactcagggagcatgaaaaactattt
atggaagtttgcagaaattgttcagctgtattatgctgtcgtatggctccactgcagaaa
gcaaaagtaataagactaataaaaatatcacctgagaaacctataacattggctgttggt
gatggtgctaatgacgtaagcatgatacaagaagcccatgttggcataggaatcatgggt
aaagaaggaagacaggctgcaagaaacagtgactatgcaatagccagatttaagttcctc
tccaaattgctttttgttcatggtcatttttattatattagaatagctacccttgtacag
tattttttttataagaatgtgtgctttatcacaccccagtttttatatcagttctactgt
ttgttttctcagcaaacattgtatgacagcgtgtacctgactttatacaatatttgtttt
acttccctacctattctgatatatagtcttttggaacagcatgtagaccctcatgtgtta
caaaataagcccaccctttatcgagacattagtaaaaaccgcctcttaagtattaaaaca
tttctttattggaccatcctgggcttcagtcatgcctttattttcttttttggatcctat
ttactaatagggaaagatacatctctgcttggaaatggccagatgtttggaaactggaca
tttggcactttggtcttcacagtcatggttattacagtcacagtaaagatggctctggaa
actcatttttggacttggatcaaccatctcgttacctggggatctattatattttatttt
gtattttccttgttttatggagggattctctggccatttttgggctcccagaatatgtat
tttgtgtttattcagctcctgtcaagtggttctgcttggtttgccataatcctcatggtt
gttacatgtctatttcttgatatcataaagaaggtctttgaccgacacctccaccctaca
agtactgaaaaggcacagcttactgaaacaaatgcaggtatcaagtgcttggactccatg
tgctgtttcccggaaggagaagcagcgtgtgcatctgttggaagaatgctggaacgagtt
ataggaagatgtagtccaacccacatcagcagatcatggagtgcatcggatcctttctat
accaacgacaggagcatcttgactctctccacaatggactcatctacttgttaa

DBGET integrated database retrieval system