KEGG   Homo sapiens (human): 23204
Entry
23204             CDS       T01001                                 
Symbol
ARL6IP1, AIP1, ARL6IP, ARMER, SPG61
Name
(RefSeq) ADP ribosylation factor like GTPase 6 interacting protein 1
  KO
K24864  ADP-ribosylation factor-like protein 6-interacting protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23204 (ARL6IP1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    23204 (ARL6IP1)
SSDB
Motif
Pfam: Reticulon TraG_N BCL_N
Other DBs
NCBI-GeneID: 23204
NCBI-ProteinID: NP_055976
OMIM: 607669
HGNC: 697
Ensembl: ENSG00000170540
Pharos: Q15041(Tbio)
UniProt: Q15041 A0A024QYV7
Position
16:complement(18791667..18801549)
AA seq 203 aa
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY
YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV
GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII
LKYIGMAKREINKLLKQKEKKNE
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggagggagataatcgcagcaccaacctgctggctgcagagactgcaagtctggaa
gaacagctgcaaggatggggagaagtgatgctgatggctgataaagtcctccgatgggaa
agagcctggtttccacctgccatcatgggtgtggtttctttggtgtttctgattatctac
tatctagatccatctgttctgtccggcgtttcctgttttgttatgtttttgtgcttggct
gactaccttgttcccattctagcgcctagaatttttggctccaataaatggaccactgaa
caacagcaaagattccatgaaatttgcagcaatctagtaaaaactcgacgcagagctgtg
ggttggtggaaacgcctcttcacactaaaggaagaaaaacctaagatgtacttcatgacc
atgatcgtttcccttgctgcggttgcttgggtgggacaacaagtccacaacctgcttctc
acctacctgatagtgacttccttactattgcttcctggactaaaccaacatggaatcatt
ttgaagtacattggaatggccaagagggagataaacaaacttctcaaacaaaaagaaaag
aaaaacgaatga

DBGET integrated database retrieval system