KEGG   Homo sapiens (human): 2322Help
Entry
2322              CDS       T01001                                 

Gene name
FLT3, CD135, FLK-2, FLK2, STK1
Definition
(RefSeq) fms related tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05230  Central carbon metabolism in cancer
Network
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00031  Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
N00119  MLL-AF4 fusion to transcriptional activation
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
Disease
H00003  Acute myeloid leukemia (AML)
Drug target
Cabozantinib (DG01670): D10062 D10095
Crenolanib (DG01361): D10102 D10103
Dovitinib lactate: D08907
Gilteritinib (DG01948): D10709 D10800
Lestaurtinib: D04696
Midostaurin: D05029
Quizartinib (DG01364): D09955 D09956
Semaxanib: D05819
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2322 (FLT3)
   04010 MAPK signaling pathway
    2322 (FLT3)
   04151 PI3K-Akt signaling pathway
    2322 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2322 (FLT3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2322 (FLT3)
   05230 Central carbon metabolism in cancer
    2322 (FLT3)
   05202 Transcriptional misregulation in cancer
    2322 (FLT3)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    2322 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2322 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2322 (FLT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2322 (FLT3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   2322 (FLT3)
CD molecules [BR:hsa04090]
 Proteins
  2322 (FLT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig I-set Ig_3 Ig_2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 2322
NCBI-ProteinID: NP_004110
OMIM: 136351
HGNC: 3765
Ensembl: ENSG00000122025
Vega: OTTHUMG00000016646
Pharos: P36888(Tclin)
UniProt: P36888
Structure
PDB: 

Position
13q12.2
AA seq 993 aa AA seqDB search
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgttggcgcgcgacggcggccagctgccgctgctcgttgttttttctgcaatg
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtatcagaatccccg
gaagacctcgggtgtgcgttgagaccccagagctcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacactgcaagtgctggtcgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctgttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgaccaatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtcttgataacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaatttaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcggcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacagaa
ggagtctggaatagaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaacctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaggaggacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgcttgtcacc
cacgggaaagtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccccgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatatggaatattactgtgggaa
atcttctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaatcctgctgggcttttgactcaaggaaacggccatccttccctaatttgact
tcgtttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggc
cgtgtttcggaatgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
ttggggctactctctccgcaggctcaggtcgaagattcgtag

DBGET integrated database retrieval system