KEGG   Homo sapiens (human): 23220Help
Entry
23220             CDS       T01001                                 

Gene name
DTX4, RNF155
Definition
(RefSeq) deltex E3 ubiquitin ligase 4
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    23220 (DTX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23220 (DTX4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23220 (DTX4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23220 (DTX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WWE zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-rbx1 zf-RING_5 zf-RING_11 zf-ANAPC11 PHD Zn_ribbon_17 zf-UDP Trm112p
Motif
Other DBs
NCBI-GeneID: 23220
NCBI-ProteinID: NP_055992
OMIM: 616110
HGNC: 29151
Ensembl: ENSG00000110042
Vega: OTTHUMG00000167336
Pharos: Q9Y2E6(Tdark)
UniProt: Q9Y2E6
Position
11q12.1
AA seq 619 aa AA seqDB search
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQ
HPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGP
ATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPL
DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPP
VSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPP
GKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
LAELAAQGISEDSTAQEKD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcctcggccgtggtggtctgggaatggctgaacgagcacggccgctggcgt
ccctacagcccagcggtgagccaccacatcgaggcggtggtccgcgccggcccccgcgcg
gggggcagcgtggtgctgggccaggtggacagccgtctcgcgccctacatcatcgacctg
cagtccatgaaccagttccgccaagacacgggaactctccgcccagttcgccgcaactac
tacgacccctcctcggcccctgggaagggcgtggtgtgggagtgggagaacgacaatggc
tcctggacgccctacgacatggaagtgggcatcaccatccagcatgcctatgagaagcag
cacccctggatcgacctcacttccattggctttagctacgtaattgacttcaacaccatg
ggccagatcaaccgtcagacccagcgccaacgccgcgtccgccggcgcctcgacctcatc
taccccatggtcacagggaccttgcctaaggctcagtcctggccagtcagccctgggcca
gccacctcgccccccatgtccccctgctcctgtccccagtgtgtcttggtgatgagtgtt
aaggcagccgtggtcaatggcagcactgggcccctacagctgccagtgacccgcaagaac
atgccgcctcctggagtggtcaagctacccccactgccaggctctggggccaagccactg
gacagcacaggcaccattcgaggcccactgaagaccgccccatcgcaggtgatccggaga
caagcctccagcatgcccactgggacaaccatgggctctcctgccagtcccccaggaccc
aacagcaagaccggaagggtggccctggccaccttgaatcgtaccaacctgcagcgactg
gccattgcccagtcccgggtgctgatcgcctctggggtccccacagtcccagtgaagaac
ctaaatgggtccagtcctgtcaaccctgccttggcaggaatcactgggatcctcatgagt
gcagcggggctgcctgtgtgtctcaccaggccaccaaagctggtcctacacccacccccc
gtcagcaagagtgaaataaaatccatcccaggggtttccaacacaagccgcaagaccacc
aaaaaacaagccaagaaaggtaaaaccccagaggaagtgctaaaaaaatatctacagaaa
gtccggcacccaccagatgaggactgcaccatctgtatggaacgcctcacggccccctca
ggctacaagggcccgcagcctacggtaaaacctgacctggtagggaagctgtccagatgc
ggccacgtctaccacatctactgcttggttgccatgtacaacaatgggaacaaggatgga
agtttgcagtgtccaacctgcaagaccatttatggggtgaagacaggcacccaacctcca
gggaagatggagtaccacctcatcccccactccttgcctggccacccagactgcaaaacc
atccggatcatctacagcatcccccccggcattcagggaccggaacacccgaatcctggg
aagagtttcagcgcccgaggcttcccacgacactgttaccttccggacagcgagaaaggg
agaaaagttctgaagctgctgctcgtggcctgggatcgccgcctcatttttgccattggc
acctccagcaccacaggcgagtcagacaccgtcatctggaatgaggtccaccacaagaca
gagtttggctctaatctcactggccatggctacccagatgccaattacctggataatgtg
ctggctgaactggctgcccagggcatctctgaggacagcactgcccaggagaaggactga

DBGET integrated database retrieval system