KEGG   Homo sapiens (human): 23224Help
Entry
23224             CDS       T01001                                 

Gene name
SYNE2, EDMD5, KASH2, NUA, NUANCE, Nesp2, Nesprin-2, SYNE-2, TROPH
Definition
(RefSeq) spectrin repeat containing nuclear envelope protein 2
  KO
K19346  nesprin-2
Organism
hsa  Homo sapiens (human)
Disease
H00563  Emery-Dreifuss muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23224 (SYNE2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    23224 (SYNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CH KASH Spectrin CAMSAP_CH NPV_P10
Motif
Other DBs
NCBI-GeneID: 23224
NCBI-ProteinID: NP_055995
OMIM: 608442
HGNC: 17084
Ensembl: ENSG00000054654
Vega: OTTHUMG00000140349
Pharos: Q8WXH0(Tbio)
UniProt: Q8WXH0
Structure
PDB: 

Position
14q23.2
AA seq 6885 aa AA seqDB search
MASSPELPTEDEQGSWGIDDLHISLQAEQEDTQKKAFTCWINSQLARHTSPSVISDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLRNRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEKLAQTLSCNYNQPSLDDVSVVDSSPASSPPAKKCSKVQARWQ
MSARKALLLWAQEQCATYESVNVTDFKSSWRNGMAFLAIIHALRPDLIDMKSVKHRSNKD
NLREAFRIAEQELKIPRLLEPEDVDVVDPDEKSIMTYVAQFLQYSKDAPGTGEEAQGKVK
DAMGWLTLQKEKLQKLLKDSENDTYFKKYNSLLSFMESFNEEKKSFLDVLSIKRDLDELD
KDHLQLREAWDGLDHQINAWKIKLNYALPPPLHQTEAWLQEVEELMDEDLSASQDHSQAV
TLIQEKMTLFKSLMDRFEHHSNILLTFENKDENHLPLVPPNKLEEMKRRINNILEKKFIL
LLEFHYYKCLVLGLVDEVKSKLDIWNIKYGSRESVELLLEDWHKFIEEKEFLARLDTSFQ
KCGEIYKNLAGECQNINKQYMMVKSDVCMYRKNIYNVKSTLQKVLACWATYVENLRLLRA
CFEETKKEEIKEVPFETLAQWNLEHATLNEAGNFLVEVSNDVVGSSISKELRRLNKRWRK
LVSKTQLEMNLPLMIKKQDQPTFDNSGNILSKEEKATVEFSTDMSVELPENYNQNIKAGE
KHEKENEEFTGQLKVAKDVEKLIGQVEIWEAEAKSVLDQDDVDTSMEESLKHLIAKGSMF
DELMARSEDMLQMDIQNISSQESFQHVLTTGLQAKIQEAKEKVQINVVKLIAALKNLTDV
SPDLDIRLKMEESQKELESYMMRAQQLLGQRESPGELISKHKEALIISNTKSLAKYLKAV
EELKNNVTEDIKMSLEEKSRDVCAKWESLHHELSLYVQQLKIDIEKGKLSDNILKLEKQI
NKEKKLIRRGRTKGLIKEHEACFSEEGCLYQLNHHMEVLRELCEELPSQKSQQEVKRLLK
DYEQKIERLLKCASEIHMTLQPTAGGTSKNEGTITTSENRGGDPHSEAPFAKSDNQPSTE
KAMEPTMKFSLASVLRPLQEESIMEKDYSASINSLLERYDTYRDILEHHLQNNKFRITSD
FSSEEDRSSSCLQAKLTDLQVIKNETDARWKEFEIISLKLENHVNDIKKPFVIKERDTLK
ERERELQMTLNTRMESLETALRLVLPVEKASLLLCGSDLPLHKMAIQGFHLIDADRIYQH
LRNIQDSIAKQIEICNRLEEPGNFVLKELHPFDLHAMQNIILKYKTQFEGMNHRVQRSED
TLKALEDFLASLRTAKLSAEPVTDLSASDTQVAQENTLTVKNKEGEIHLMKDKAKHLDKC
LKMLDMSFKDAERGDDTSCENLLDAFSIKLSETHGYGVQEEFTEENKLLEACIFKNNELL
KNIQDVQSQISKIGLKDPTVPAVKHRKKSLIRLDKVLDEYEEEKRHLQEMANSLPHFKDG
REKTVNQQCQNTVVLWENTKALVTECLEQCGRVLELLKQYQNFKSILTTLIQKEESVISL
QASYMGKENLKKRIAEIEIVKEEFNEHLEVVDKINQVCKNLQFYLNKMKTFEEPPFEKEA
NIIVDRWLDINEKTEDYYENLGRALALWDKLFNLKNVIDEWTEKALQKMELHQLTEEDRE
RLKEELQVHEQKTSEFSRRVAEIQFLLQSSEIPLELQVMESSILNKMEHVQKCLTGESNC
HALSGSTAELREDLDQAKTQIGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMILL
ENQIGCLTPELSELKKQYESVSDLFNTKKSVLQDHFSKLLNDQCKNFNDWFSNIKVNLKE
CFESSETKKSVEQKLQKLSDFLTLEGRNSKIKQVDSVLKHVKKHLPKAHVKELISWLVGQ
EFELEKMESICQARAKELEDSLQQLLRLQDDHRNLRKWLTNQEEKWKGMEEPGEKTELFC
QALARKREQFESVAQLNNSLKEYGFTEEEEIIMEATCLMDRYQTLLRQLSEIEEEDKLLP
TEDQSFNDLAHDVIHWIKEIKESLMVLNSSEGKMPLEERIQKIKEIILLKPEGDARIETI
MKQAESSEAPLVQKTLTDISNQWDNTLHLASTYLSHQEKLLLEGEKYLQSKEDLRLMLIE
LKKKQEAGFALQHGLQEKKAQLKIYKKFLKKAQDLTSLLKELKSQGNYLLECTKNPSFSE
EPWLEIKHLHESLLQQLQDSVQNLDGHVREHDSYQVCVTDLNTTLDNFSKEFVSFSDKPV
DQIAVEEKLQKLQELENRLSLQDGTLKKILALAKSVKQNTSSVGQKIIKDDIKSLQCKQK
DLENRLASAKQEMECCLNSILKSKRSTEKKGKFTLPGREKQATSDVQESTQESAAVEKLE
EDWEINKDSAVEMAMSKQLSLNAQESMKNTEDERKVNELQNQPLELDTMLRNEQLEEIEK
LYTQLEAKKAAIKPLEQTECLNKTETGALVLHNIGYSAQHLDNLLQALITLKKNKESQYC
VLRDFQEYLAAVESSMKALLTDKESLKVGPLDSVTYLDKIKKFIASIEKEKDSLGNLKIK
WENLSNHVTDMDKKLLESQIKQLEHGWEQVEQQIQKKYSQQVVEYDEFTTLMNKVQDTEI
SLQQQQQHLQLRLKSPEERAGNQSMIALTTDLQATKHGFSVLKGQAELQMKRIWGEKEKK
NLEDGINNLKKQWETLEPLHLEAENQIKKCDIRNKMKETILWAKNLLGELNPSIPLLPDD
ILSQIRKCKVTHDGILARQQSVESLAEEVKDKVPSLTTYEGSDLNNTLEDLRNQYQMLVL
KSTQRSQQLEFKLEERSNFFAIIRKFQLMVQESETLIIPRVETAATEAELKHHHVTLEAS
QKELQEIDSGISTHLQELTNIYEELNVFERLFLEDQLKNLKIRTNRIQRFIQNTCNEVEH
KIKFCRQFHEKTSALQEEADSIQRNELLLNQEVNKGVKEEIYNLKDRLTAIKCCILQVLK
LKKVFDYIGLNWDFSQLDQLQTQVFEKEKELEEKIKQLDTFEEEHGKYQALLSKMRAIDL
QIKKMTEVVLKAPDSSPESRRLNAQILSQRIEKAKCLCDEIIKKLNENKTFDDSFKEKEI
LQIKLNAEENDKLYKVLQNMVLELSPKELDEKNCQDKLETSLHVLNQIKSQLQQPLLINL
EIKHIQNEKDNCEAFQEQVWAEMCSIKAVTAIEKQREENSSEASDVETKLREFEDLQMQL
NTSIDLRTNVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQ
EELESTVAHIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAERYLEN
YKCYRKMEEDIYTNLSKMETVLGQSMSSLPLSYREALERLEQSKALVSNLISTKEELMKL
RQILRLLRLRCTENDGICLLKIVSALWEKWLSLLEAAKEWEMWCEELKQEWKFVSEEIER
EAIILDNLQEELPEISKTKEAATTEELSELLDCLCQYGENVEKQQLLLTLLLQRIRSIQN
VPESSGAVETVPAFQEITSMKERCNKLLQKVQKNKELVQTEIQERHSFTKEIIALKNFFQ
QTTTSFQNMAFQDHPEKSEQFEELQSILKKGKLTFENIMEKLRIKYSEMYTIVPAEIESQ
VEECRKALEDIDEKISNEVLKSSPSYAMRRKIEEINNGLHNVEKMLQQKSKNIEKAQEIQ
KKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDNLMIPFQQYQQVSQRAECRTSQL
NKATVKMEEYSDLLKSTEAWIENTSHLLANPADYDSLRTLSHHASTVQMALEDSEQKHNL
LHSIFMDLEDLSIIFETDELTQSIQELSNQVTALQQKIMESLPQIQRMADDVVAIESEVK
SMEKRVSKIKTILLSKEIFDFSPEEHLKHGEVILENIRPMKKTIAEIVSYQVELRLPQTG
MKPLPVFQRTNQLLQDIKLLENVTQEQNELLKVVIKQTNEWDEEIENLKQILNNYSAQFS
LEHMSPDQADKLPQLQGEIERMEKQILSLNQRKEDLLVDLKATVLNLHQHLKQEQEGVER
DRLPAVTSEEGGVAERDASERKLNRRGSMSYLAAVEEEVEESSVKSDNGDEKAEPSPQSW
SSLWKHDKDMEEDRASSSSGTIVQEAYGKISTSDNSMAQILTPDSLNTEQGPECSLRPNQ
TEEGTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQQANVAVE
PETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLK
TVKCNLEKVQMMLQEKHSEDQHPTILKKSSEPEHQEALQPVNLSELESIVTERPQFSRQK
DFQQQQVLELKPMEQKDFIKFIEFNAKKMWPQYCQHDNDTTQESSASNQASSPENDVPDS
ILSPQGQNGDKWQYLHHELSSKIKLPLPQLVEPQVSTNMGILPSVTMYNFRYPTTEELKT
YTTQLEDLRQEASNLQTQENMTEEAYINLDKKLFELFLTLSQCLSSVEEMLEMPRLYRED
GSGQQVHYETLALELKKLYLALSDKKGDLLKAMTWPGENTNLLLECFDNLQVCLEHTQAA
AVCRSKSLKAGLDYNRSYQNEIKRLYHQLIKSKTSLQQSLNEISGQSVAEQLQKADAYTV
ELENAESRVAKLRDEGERLHLPYALLQEVYKLEDVLDSMWGMLRARYTELSSPFVTESQQ
DALLQGMVELVKIGKEKLAHGHLKQTKSKVALQAQIENHKVFFQKLVADMLLIQAYSAKI
LPSLLQNRETFWAEQVTEVKILEEKSRQCGMKLQSLLQKWEEFDENYASLEKDLEILIST
LPSVSLVEETEERLVERISFYQQIKRNIGGKHARLYQTLNEGKQLVASVSCPELEGQIAK
LEEQWLSLNKKIDHELHRLQALLKHLLSYNRDSDQLTKWLESSQHTLNYWKEQSLNVSQD
LDTIRSNINNFFEFSKEVDEKSSLKTAVISIGNQLLHLKETDTATLRASLAQFEQKWTML
ITQLPDIQEKLHQLQMEKLPSRKAITEMISWMNNVEHQTSDEDSVHSPSSASQVKHLLQK
HKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWHRVHGMLNR
KIQHLEQLLESITESENKIQILNNWLEAQEERLKTLQKPESVISVQKLLLDCQDIENQLA
IKSKALDELKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQVNQLKTSMQSVLQEWK
IYDQLYDEVNMMTIRFWYCMEHSKPVVLSLETLRCQVENLQSLQDEAESSEGSWEKLQEV
IGKLKGLCPSVAEIIEEKCQNTHKRWTQVNQAIADQLQKAQSLLQLWKAYSNAHGEAAAR
LKQQEAKFQQLANISMSGNNLAEILPPALQDIKELQHDVQKTKEAFLQNSSVLDRLPQPA
ESSTHMLLPGPLHSLQRAAYLEKMLLVKANEFEFVLSQFKDFGVRLESLKGLIMHEEENL
DRLHQQEKENPDSFLNHVLALTAQSPDIEHLNEVSLKLPLSDVAVKTLQNMNRQWIRATA
TALERCSELQGIGLNEKFLYCCEKWIQLLEKIEEALKVDVANSLPELLEQQKTYKMLEAE
VSINQTIADSYVTQSLQLLDTTEIENRPEFITEFSKLTDRWQNAVQGVRQRKGDVDGLVR
QWQDFTTSVENLFRFLTDTSHLLSAVKGQERFSLYQTRSLIHELKNKEIHFQRRRTTCAL
TLEAGEKLLLTTDLKTKESVGRRISQLQDSWKDMEPQLAEMIKQFQSTVETWDQCEKKIK
ELKSRLQVLKAQSEDPLPELHEDLHNEKELIKELEQSLASWTQNLKELQTMKADLTRHVL
VEDVMVLKEQIEHLHRQWEDLCLRVAIRKQEIEDRLNTWVVFNEKNKELCAWLVQMENKV
LQTADISIEEMIEKLQKDCMEEINLFSENKLQLKQMGDQLIKASNKSRAAEIDDKLNKIN
DRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQ
KRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNI
CAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTSAKEELKRFE
AFQRQIHERLTQLELINKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQRRVTAVLRRL
RHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKI
DQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSCTPGLEDEKEA
SENETDMEDPREIQTDSWRKRGESEEPSSPQSLCHLVAPGHERSGCETPVSVDSIPLEWD
HTGDVGGSSSHEEDEEGPYYSALSGKSISDGHSWHVPDSPSCPEHHYKQMEGDRNVPPVP
PASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGNPQQEDGGLAGITEQQSGAFDRWEMIQA
QELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEIELRVKRLQEIL
KAFDTYKALVVSVNVSSKEFLQTESPESTELQSRLRQLSLLWEAAQGAVDSWRGGLRQSL
MQCQDFHQLSQNLLLWLASAKNRRQKAHVTDPKADPRALLECRRELMQLEKELVERQPQV
DMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSF
DEVDSGDQPPATSVPAPRAKQFRAVRTTEGEEETESRVPGSTRPQRSFLSRVVRAALPLQ
LLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPMLRYTNGPPPT
NT seq 20658 nt NT seq  +upstreamnt  +downstreamnt
atggcatctagtcctgagcttcccaccgaagatgaacagggttcctggggcatcgacgat
ctccatatttcattgcaagctgaacaggaagacacccagaagaaagccttcacgtgctgg
ataaactcacagttggccaggcacacttctccctcagttatatccgacctattcacagac
attaaaaaggggcatgtcctcctggatctgctagaagtactttctgggcaacagttgcct
cgggataaaggatctaataccttccagtgtagaatcaatatagaacatgccttgacattc
ctaagaaaccgatcaattaagctaataaatattcatgttactgatatcattgatggaaac
ccatccattatccttggcctaatttggacaattatcctgcactttcatattgagaagctt
gcccagactctttcttgcaattacaatcagccttccctggatgatgtgagtgtggttgac
tcatctcctgcctcaagtcctccagctaagaaatgctctaaagtgcaagcaagatggcaa
atgtctgcaagaaaggcccttcttttgtgggctcaggaacaatgcgccacctatgagtct
gtcaatgtgaccgattttaagtcaagttggagaaatgggatggcttttttggccatcatt
catgccttgcgaccagacctaattgacatgaagagtgtgaagcatagatccaacaaagac
aatctgagagaggccttcagaattgcagaacaagaattaaaaatccccagattgctggaa
ccagaagatgtggatgttgttgatcctgatgaaaagtccatcatgacctatgtggcacag
tttctgcagtattccaaagatgcccctgggactggagaggaggctcagggaaaggtgaaa
gatgctatgggctggttaactctgcaaaaggaaaaactacagaagttgctaaaggattca
gagaatgatacctactttaaaaagtataatagcctgctgtcctttatggagtcattcaat
gaagaaaaaaagtcctttttggatgtcctgtcaataaaacgggatctggatgagctggac
aaggatcatttacagttgagagaagcctgggatggcctcgatcaccagattaatgcatgg
aaaataaagctaaattatgccttgcccccacccctccatcaaactgaagcttggctccag
gaggtagaagagcttatggatgaagatttgtcagcctcccaggatcactctcaagccgtg
actctgatacaagagaaaatgactttattcaagagcctgatggatagatttgagcatcat
tcgaacattctccttacctttgaaaataaggatgaaaatcacttgccattggtaccacct
aacaaattggaggaaatgaaaagacgaatcaacaacattttggagaaaaaatttattcta
cttctagaatttcattactacaagtgcttagttcttggtttggtagatgaagtgaaatca
aaattggatatttggaacattaaatatgggagcagagaatctgtggaattattgctggaa
gactggcataaatttattgaagaaaaagaattcctagctcgacttgatacttcttttcaa
aaatgtggagaaatttataagaatttggctggagaatgtcagaatattaataaacagtat
atgatggtgaaatctgatgtttgtatgtatagaaaaaatatatataatgtgaagtccact
ctacaaaaagtgctggcatgttgggctacttatgtggaaaaccttcgcttactaagggct
tgctttgaggagacaaagaaggaagaaattaaagaggtaccctttgagacactagcccag
tggaatctagaacacgctactttaaatgaagcaggaaatttcttagtcgaagtcagcaat
gatgtggttggatcatctatttctaaagaactgagaaggctgaataaaagatggagaaag
ttggtttcaaaaactcaacttgaaatgaacctgccactgatgataaaaaaacaggatcag
cccacttttgacaattctggaaatattctatctaaagaagagaaagcaactgttgagttt
tcaacagatatgtcagtagaacttcctgaaaattataatcaaaatataaaggctggagag
aaacatgaaaaagaaaatgaagaattcacagggcaactaaaagtggctaaagatgttgaa
aaactcattggacaagtggaaatctgggaggcagaagccaaatctgttttggatcaagat
gatgtggacacctcaatggaagaatctttgaagcatcttattgccaaaggctctatgttt
gatgagcttatggcaagaagtgaagatatgttacaaatggatatacaaaatatttcaagc
caggagtcctttcaacatgttctcacaactgggcttcaggcaaagattcaagaagctaaa
gagaaagtccagatcaatgtggtaaaactcattgcagcgttgaagaacttaactgacgtt
tcaccagatttggacatcaggctgaagatggaagaatcccagaaggaacttgaatcatat
atgatgagggctcagcagttactggggcaaagagagagccccggtgaactcatttcaaaa
cacaaggaagcactaataatttctaatacaaaaagtctggccaagtatttgaaagctgtt
gaagaactaaaaaataatgtaactgaggacataaagatgtctttagaagaaaagagtaga
gatgtctgtgccaaatgggagtctcttcatcatgaactgtctttatatgttcaacaacta
aaaatagatattgaaaaaggaaagcttagtgacaatattttaaaacttgaaaagcaaata
aataaagaaaagaaacttatccgtagaggaaggaccaagggtctcatcaaagaacatgag
gcctgcttttctgaggaaggctgcctgtaccagcttaatcaccacatggaagtcctgagg
gagctgtgtgaagagctgccttcacagaagagtcaacaagaagtgaagagactactcaaa
gattatgaacaaaagatagaaagacttctgaaatgtgcttccgagattcatatgacactg
cagcccacagcgggaggcacgtcgaaaaacgaggggaccatcaccacatctgagaataga
ggaggggatccccacagtgaggcaccatttgcaaaatcagataatcagccatcaactgaa
aaggcaatggaacccactatgaagtttagcctggcatcagtgttaaggcctctgcaagaa
gaaagcattatggaaaaggattacagtgcatctataaatagtttactagagaggtatgat
acatacagagatattcttgaacaccacctgcaaaacaacaaattcaggattacttctgat
ttctctagtgaagaggacaggagtagttcttgtctgcaggctaaactgacagatctacag
gtcataaaaaatgaaactgatgctcgctggaaagagtttgaaattatttcattgaagtta
gaaaatcatgtgaatgacataaaaaagccttttgtaattaaggaaagagacacactaaag
gaaagagaaagagagcttcagatgactcttaataccagaatggaatctttagagacagca
ctgcggcttgtgttacctgtagagaaggcatcacttcttctctgtggctcggacctgcct
ctccataaaatggccatccagggatttcatctcattgatgctgatcgcatctatcaacac
ctaaggaatatccaagattccatagcaaaacagattgaaatatgtaaccgcttagaagag
ccaggcaactttgtattaaaggagttacacccatttgatctacacgcaatgcagaatatt
atactgaaatacaaaacacaatttgaaggaatgaaccacagggtgcagaggagtgaagat
actctcaaagctctggaagactttttggcgtctctcagaacagctaaactctctgctgag
cccgttacagacctttcagcctcagatacacaggtggcacaagaaaatacgttgacagta
aaaaataaagagggagaaattcatctgatgaaagacaaggccaaacatttggataaatgt
ttgaagatgctcgatatgagctttaaagatgctgaacggggtgatgacacctcctgtgaa
aacctgcttgatgctttttcaataaagttatctgagacacatggctatggggtacaggag
gaattcactgaggaaaacaaattactagaggcttgtattttcaaaaataatgaactcctt
aaaaatattcaagatgtgcagagtcaaatcagtaaaattggtcttaaggatcctactgtt
ccagctgtgaaacatcggaaaaaatcattaatcagactggataaggttctagatgaatat
gaagaagagaagagacatttacaagaaatggctaattctcttccacacttcaaagatggc
agagaaaaaaccgtgaatcaacagtgccaaaatacagtagtcttgtgggagaataccaaa
gccttggtcaccgaatgtcttgaacaatgtgggagagttttggagctcttaaaacaatat
cagaattttaaaagcatcttgacaactttgattcaaaaagaagagagtgtcatctccctg
caggcttcgtacatgggaaaggagaacctgaagaaaaggatagcagagattgaaattgtc
aaagaagaatttaatgagcatttagaagttgtagacaagataaaccaggtctgcaaaaat
ctacaattttatctaaataaaatgaaaacttttgaagagcccccttttgaaaaagaggct
aatattattgtggatagatggcttgatataaatgagaagacagaagattactatgaaaat
cttggtcgagctctagctttgtgggacaaactttttaacttaaaaaatgtcattgatgag
tggacagaaaaggcccttcaaaaaatggaattacatcaattgactgaagaggacagagaa
aggctgaaggaagaattacaagtccatgaacaaaaaacttcagaattttctagaagagtg
gctgaaatacagtttttgctccaaagcagtgaaatacctcttgaattgcaggtcatggag
tcctctattttgaacaagatggaacatgtacagaagtgcttaacaggagaatccaactgc
catgcactcagtggcagcactgctgagctaagggaggatctcgaccaagccaagacccag
atcgggatgactgaatccctcttaaaagccctgtctccttctgacagcttggagatcttc
actaaactagaggagatacaacagcagattctacagcaaaaacacagtatgatattactt
gagaatcaaataggttgtctgactcctgaactctctgaattgaaaaagcaatatgaaagt
gtcagtgatttatttaataccaaaaaaagtgttttgcaagatcacttttctaagttattg
aatgatcaatgcaagaactttaatgactggttcagcaacattaaagtgaaccttaaggag
tgttttgaatcatcagaaacaaaaaagagtgtggaacaaaagctacaaaaactttctgat
ttcttgactcttgaaggaagaaacagtaaaataaagcaggtggacagcgtactgaagcat
gtgaagaagcatctgcccaaagcacatgtgaaggagcttatcagttggctcgtgggtcag
gaattcgaattagaaaaaatggagtccatatgccaggctcgagcaaaggagcttgaagac
tccttgcagcagctactgagactccaggatgaccatagaaacctgaggaagtggttgact
aatcaagaagagaaatggaaaggaatggaagaaccaggggagaaaactgagctgttctgc
caagctttagctagaaagagggaacagtttgaatctgtggcccaattgaacaactctttg
aaggaatatgggtttactgaagaagaagaaataataatggaagcaacatgtttgatggat
agataccagacattactgagacaactaagtgaaatcgaggaagaggataagttactaccc
acagaggaccagagctttaatgatcttgcacatgatgtaattcattggataaaagagatt
aaagagtcccttatggttttgaattcatccgaaggcaaaatgccacttgaggaaagaatc
caaaaaatcaaggaaatcattttgctgaagcctgaaggggatgccagaatagagaccatc
atgaagcaggctgagagcagcgaggccccgctggttcagaagaccctcactgacatcagc
aaccagtgggacaacacactccatttagctagcacctacctaagccatcaagaaaagctt
ctactagaaggagagaaatatttacaaagtaaggaggatctgagattaatgctcatagaa
ctaaagaagaaacaggaagcaggctttgctctacaacatggtctgcaggagaagaaagct
cagttaaagatttataagaaattcctcaagaaagcccaagatttgacatccttgctaaag
gagttaaaatctcagggaaactacctcttggagtgcactaaaaatcccagcttcagtgaa
gagccttggctggaaataaagcatctacacgaaagtcttcttcaacaactgcaggattct
gtgcaaaacttggacggtcacgttcgagaacatgattcataccaggtttgcgtcacagac
ctgaatactacattggacaatttctccaaggaatttgtcagtttttctgataagcctgtg
gatcaaatagcggttgaggaaaaattgcagaaactgcaggaactagagaatagactcagt
ttacaagatggcacattaaagaagattttagctttagcaaaatccgtcaagcaaaataca
tcttcagtggggcagaagattattaaagatgatataaaatcacttcagtgtaaacaaaaa
gatttggaaaacaggcttgcatctgctaagcaggagatggaatgttgtctcaacagcatt
ctcaaatcaaaacgctcaacagaaaagaaaggaaagtttactctgccaggcagagagaag
caggccacttctgatgtgcaggagtctactcaggaatcagctgcagtggaaaagttggag
gaagactgggaaataaacaaggattcagctgtggaaatggctatgtcaaaacaactttct
cttaatgctcaagaaagcatgaaaaacactgaagatgagcggaaagtcaatgagctgcaa
aatcaacctttagaattagatactatgttaagaaatgaacaattagaagagatagagaaa
ttatatacccagttggaagcaaagaaagcagccattaagccactggaacaaacagaatgt
cttaacaaaacagaaactggggccttggttctccacaatataggatattcggcacagcat
ttggacaatttgcttcaggcacttattactttgaagaaaaacaaagaaagccaatattgt
gtcctcagagattttcaggaataccttgctgcagttgaatcttcaatgaaagccttgttg
acagacaaggaaagtcttaaagtaggaccactggacagtgtaacgtatctggacaaaatt
aaaaaattcatagcatccatagaaaaagagaaagattctttaggcaacttgaaaatcaaa
tgggagaatttatcaaaccacgtgactgacatggataagaaattgttggaaagccagatt
aagcaacttgaacatggttgggaacaagtggaacagcagattcaaaagaagtattctcag
caggtagtggaatatgatgaatttacaaccctcatgaataaggtacaggacactgagatt
tctctgcaacagcagcagcaacatctacagttaaggctgaagtctccagaagaacgggca
gggaaccaaagcatgattgccttgaccactgacctccaggctaccaagcatggattttct
gttttaaaggggcaagctgaacttcagatgaagaggatttggggagaaaaagaaaagaag
aatttggaggatggaataaataacttgaagaaacaatgggaaacattggagccattacac
ttagaagcagaaaatcagattaagaagtgtgacataaggaacaagatgaaagagactatc
ttatgggccaagaatttgttgggtgaacttaatccctccattccccttctcccagatgac
attctttcacagatcagaaagtgcaaagtgacacatgatggcattctagctaggcagcag
tctgtggaatcgttggctgaagaggtcaaagataaggttcctagccttacaacctatgag
ggcagtgatttaaataataccctagaggacttacggaatcaataccaaatgctggtttta
aaatcaactcaaagatcacagcaattagaatttaagttggaagaaagaagcaattttttt
gctataataaggaagtttcaacttatggttcaagaaagtgaaacactgataattcccagg
gtggagacagctgccacggaagctgaactaaaacatcaccatgttactttggaggcatct
cagaaggaattgcaagaaattgacagtggaatctcaacacatcttcaggagctaacaaac
atctatgaggagctgaatgtgtttgaaagattatttctggaagatcagttgaaaaatctt
aagattaggaccaacagaatacaaagattcattcagaatacatgtaatgaagtggaacac
aagataaagttttgcagacaattccatgaaaaaacatcagcgcttcaggaggaggctgac
agtatacagcgcaatgaactattacttaatcaagaagtaaataaaggtgttaaagaggag
atctataatcttaaagacagactcaccgctattaagtgttgcatcttacaggtattgaaa
cttaaaaaagtgtttgactatattggactaaactgggatttttcacaacttgaccaatta
caaacccaagtatttgaaaaagaaaaggaacttgaagaaaaaattaagcagttggacaca
tttgaggaagaacatggcaaatatcaggcattattaagtaaaatgagagctattgatttg
caaattaagaaaatgactgaagtagtactaaaagctcctgatagctctccggaaagcaga
cggctcaatgcccaaattttaagtcagagaattgagaaagccaagtgtttatgtgatgag
ataataaagaaattaaatgaaaataagacctttgatgactcattcaaggagaaagaaata
ctacaaataaagctgaatgcagaagaaaatgataagttatacaaagttctccaaaacatg
gtattagaactctcaccaaaagaattggatgaaaagaattgtcaggacaaactagaaact
tccttacatgttttaaatcagataaaatctcaattacagcagccattacttataaatttg
gaaattaaacatattcaaaatgaaaaggacaattgtgaagcatttcaggagcaagtttgg
gcagaaatgtgtagtattaaagctgtgactgctattgagaaacaaagagaagaaaactct
tctgaagcgagtgatgtggagacaaaactacgtgagtttgaagatcttcagatgcagctt
aacacaagcattgatttgcgcacaaatgtcttgaatgatgcttatgaaaatctaacacgc
tataaagaagcagtcaccagggcagtggagagcatcacttccctcgaagccatcattata
ccctacagagtagatgttggtaatccagaagaatctttagagatgcctcttcgaaaacaa
gaggaattggaatccacagtagcacacatccaggacctcactgagaaactgggaatgata
tccagccccgaagccaaactacaacttcagtatactttacaggaactagtttctaagaac
tcagcaatgaaggaagctttcaaagcacaggaaactgaggcagaaaggtatcttgagaat
tacaaatgctatagaaaaatggaagaggatatttacactaacctcagcaaaatggagaca
gttcttggacagtccatgtcctcgttgccactgtcttacagagaagctttagagcgcttg
gaacagagcaaggccttggtgtcaaatcttatatcaaccaaagaagagttaatgaaacta
cgacagatccttagactcttgagactcaggtgcacagaaaatgatggcatatgtttgctc
aagattgtgtcggctctgtgggagaaatggctgagtttgctggaagctgctaaagagtgg
gagatgtggtgcgaagaactgaagcaggaatggaaatttgtcagtgaagaaattgaacga
gaggcaattattttagataatcttcaggaagaactccctgaaatttccaaaacaaaagag
gcagccaccacagaggaactctctgagctgctagactgtttatgccaatatggagagaac
gtggagaagcaacagctgttactgactctacttcttcagcgcatcagaagtatccagaat
gttcctgaaagctcaggggctgtggaaactgttccagcatttcaagaaattacttctatg
aaagaacgatgcaacaagcttcttcagaaagttcagaaaaataaagaattggtgcagact
gaaatccaagaaagacattccttcacaaaagagataattgctttgaagaatttctttcaa
cagaccacaacttcattccaaaatatggcattccaggatcacccagaaaagtcagaacaa
tttgaggagcttcaaagcatccttaagaaagggaaactaacttttgagaatattatggaa
aaactgcgaatcaagtattccgaaatgtacaccatagtccctgcagagattgaatcccag
gtggaagaatgcagaaaagctttagaagacatagatgagaagattagcaatgaagtctta
aaaagctcaccatcatatgcaatgaggagaaaaatagaagaaattaacaatgggcttcat
aatgttgaaaagatgttgcagcagaaaagcaaaaatattgagaaagctcaagaaattcaa
aagaaaatgtgggacgagttagatctatggcattccaaactaaatgagctggattctgaa
gttcaggacattgttgaacaggacccaggacaggctcaagaatggatggataacttgatg
attcctttccagcagtatcagcaagtatcacagagagcagagtgtagaacctcacagttg
aataaggccacagttaagatggaggaatatagtgaccttctgaagagcactgaggcttgg
atagaaaataccagtcatttgctggccaatcctgctgactatgactctttgaggacactg
agtcaccatgctagcactgtgcagatggctttggaagattcagaacagaagcacaatctt
ttacattcaatctttatggatctagaagacctgtcaataatttttgaaacagatgaatta
acccaatccatacaagagttaagtaatcaagtaacagctttacaacaaaaaataatggaa
agccttccacagattcagcgaatggctgatgatgtggttgctattgaatctgaagtaaaa
tcaatggaaaaaagagtttcaaaaatcaaaactatcctattatcaaaagaaatatttgat
ttttcacctgaagaacatctcaaacatggggaggtcatacttgaaaatatacgtcccatg
aagaaaaccattgctgagatagtgtcttaccaagtggaactgaggttgccccaaacagga
atgaaacctctgcctgtgtttcagcggacaaatcagcttttacaagatataaaactattg
gaaaatgtgactcaagaacaaaatgagttattaaaggtagtcataaaacagaccaatgaa
tgggatgaagaaatagaaaatttgaaacagatcttaaataattattcagctcagttctcc
cttgaacatatgtcaccagaccaagctgacaagctgccacaactacagggagaaatcgaa
cgtatggagaaacagattctgagtttgaaccagagaaaagaagacctgttggtggacttg
aaggccaccgtactaaaccttcaccagcatttgaagcaagaacaagaaggagtagaaaga
gataggctgccagctgtaacatcagaggaaggtggagtggcagagagggatgcttctgag
cggaagttgaacagaagaggctccatgtcttacctggcagcagtcgaggaagaggtggaa
gaaagttccgtgaagagcgataatggagatgagaaggcagagccatcgcctcagtcttgg
tcttcactttggaagcatgacaaggacatggaagaagacagagcttcctcatcctctgga
acaattgttcaggaagcatatgggaaaataagcacctctgataattccatggcacaaatc
ctcacaccagactcactaaacactgagcaaggcccagaatgttccctaaggcccaaccaa
acagaagagggcaccacacctcctattgaggctgacactctggactcttctgacgcgcaa
ggaggtttggagcccagggtggagaaaactaggccggagcccacagaagtcctgcatgcc
tgcaagacccaggtggccgagctggagctgtggctgcaacaagccaacgtggcagttgag
ccggaaacattaaacgcagacatgcagcaggtgctggaacagcagctggtagggtgccag
gctatgctaacagagattgagcacaaggttgcctttctgttagagacttgcaaagatcag
ggcctgggagataatggagccactcaacatgaggctgaagcgctttccctgaaactgaaa
acagtgaagtgcaatttagaaaaagtccagatgatgcttcaggagaagcacagtgaagat
cagcatcctaccattctaaagaaatcctcagagccagagcatcaagaagctctccaacca
gttaacctttctgaattggaatccattgtaactgaaaggccacaattcagcagacaaaaa
gatttccagcagcaacaggttctggagttaaaaccaatggaacagaaagatttcatcaaa
ttcatagaatttaatgctaagaaaatgtggccccagtattgccaacatgataacgataca
actcaggaatcatctgcaagcaaccaggcatccagccctgaaaatgacgttccagactcg
atcttgtcaccccagggccaaaatggagataagtggcaatatctgcatcatgaactctca
tcaaaaataaagctcccactccctcagcttgtggagcctcaggtttccacaaatatgggt
attctacccagcgtgactatgtataactttagatacccaacaactgaagaactgaaaacc
tataccacccaacttgaagacctgcgccaagaagcaagtaaccttcagacacaggaaaat
atgacagaagaagcatatatcaatttggataaaaaattgtttgaactattcctgaccctc
agtcagtgcctcagcagtgtggaggagatgctggagatgcccagactttacagggaggat
ggttctggccagcaggtgcactacgagacgctggctcttgagttgaagaaactttattta
gcgctaagtgacaagaagggtgatcttttgaaagccatgacttggcctggcgagaacacc
aacttgctccttgaatgttttgacaaccttcaagtctgcctggagcacactcaggctgca
gctgtctgtagaagcaagtccctgaaagctggcctcgattacaaccgcagttaccagaat
gaaataaagagattatatcatcagctcattaagagtaagacatctttacaacagtctttg
aatgaaatcagtgggcagagtgttgctgaacagcttcagaaagcagatgcatatacagtg
gagctggagaacgccgagagccgagtggccaaactaagagatgaaggggagaggcttcat
ttaccttatgctttactccaggaggtttacaaattagaggatgtacttgacagtatgtgg
ggaatgctaagagccaggtacacagaactcagcagccctttcgtcactgagagccagcaa
gatgctttgttgcaaggcatggtggaactggtgaagattgggaaggaaaagcttgctcat
ggccacttaaaacaaaccaaaagtaaagtggcgttacaggctcaaatagaaaatcacaag
gtttttttccagaagcttgttgctgacatgttgttgatccaagcatactctgccaaaata
cttccttctttattgcaaaacagagagacattttgggcagaacaagtaacagaagttaaa
atactagaagaaaagtcacgccaatgtggtatgaagctgcagagtttgttgcagaaatgg
gaagaatttgatgaaaactatgcatctcttgaaaaggacctggaaattcttatatctaca
ttgccctctgtgagtttggtggaagaaacagaggaaagattagtggaaaggatttcattt
taccagcaaataaaaagaaacattggtggaaaacacgcccggctttaccaaactctgaac
gaaggcaaacagttggtggcgtctgtgagctgtcctgaattagagggccagatcgcaaaa
ctggaagagcagtggttgtccctgaacaagaaaattgaccatgagctccacaggctgcaa
gctcttctcaagcatctgctcagttataacagagattcggatcagttaaccaagtggttg
gaatcttcccagcatactctgaattactggaaagaacagtccctcaatgtgtctcaggac
ttggatacaatcagaagcaacatcaacaatttttttgagttttcaaaagaagttgatgaa
aaatcctccttgaagactgccgttatcagtatcgggaaccagcttcttcacctgaaagaa
actgatacagctacactgagagcttctttagcacagtttgaacaaaaatggacaatgctc
ataactcaacttccagatattcaagaaaaacttcaccagcttcaaatggagaaattgccg
tctcgtaaagcaatcacagaaatgattagctggatgaacaatgtggagcatcaaacttca
gatgaagactccgtgcattcaccaagttctgcatctcaagttaaacatcttcttcagaag
cacaaggagtttagaatggaaatggactataaacagtggatagttgacttcgttaaccag
tcattacttcagctaagcacctgtgatgtagaaagcaagcgctatgaaagaacggagttt
gcagagcacctgggggagatgaaccgccagtggcaccgtgtacatggaatgctgaataga
aagatacaacatttagaacaacttctagaaagtatcactgagagtgaaaataaaatacag
atcttgaacaactggctggaagcacaagaagagagactgaaaactttacaaaaacctgaa
agtgtgatctcagtgcagaagctgctcctggactgtcaggatatagaaaatcaacttgca
attaaatccaaagcactagatgagttgaaacaaagttatctgactttggagagtggggca
gtgccattgttagaagatacagcatcccgaattgatgagttatttcaaaagagaagcagt
gttctcactcaggtcaatcagctcaaaacctccatgcagtcagttttacaggagtggaag
atttatgatcaactctatgatgaagtgaatatgatgacaatccgattctggtactgcatg
gaacacagcaagcctgtggtgttatcattggagaccttgagatgccaggtggagaacctt
cagtctctgcaagatgaagctgagagcagtgaagggagttgggagaaactccaggaggtt
atcggcaaactcaaaggtctctgcccctctgttgctgaaataatcgaagagaaatgccaa
aatactcataaaaggtggactcaggtgaaccaagccattgcagaccagttgcagaaggcc
cagagtctgctccagctctggaaggcctatagcaatgctcatggtgaagctgccgcaagg
ctgaagcagcaggaagcaaagtttcaacagctcgcaaacatcagcatgtctggaaacaac
ctggcagagatcctgcccccagccctgcaggacataaaggagctgcagcatgatgtgcag
aaaacaaaagaagcctttctccaaaattccagtgtcctggatcgactcccacaacccgca
gagtccagcacccacatgctcctcccgggccccctgcactctctccagagggctgcttat
ttggaaaagatgctgcttgtgaaagcaaatgaatttgagtttgttctctcacagtttaag
gattttggagtccggctggaatctttaaaaggtcttattatgcatgaagaagagaatttg
gatagacttcaccaacaggaaaaagaaaatcctgactcattcctgaatcatgtgctggca
ctgacagcccaatcacctgatattgaacatttgaatgaagtgagcctcaagctcccactt
agtgacgtagctgtgaagacgttacaaaatatgaaccggcaatggattcgggccacggcc
acggcactggagcgctgcagtgagcttcagggaattggattgaatgaaaagtttctttat
tgctgtgaaaagtggatccaacttttggagaagatagaagaagcactcaaagtggatgtg
gctaacagccttcctgagctcctggagcagcagaaaacctataagatgttagaagctgaa
gtttctataaaccagacaattgctgattcctatgtcacccagtccttacaactcctggac
acaacagaaatagagaacagaccagaatttattacagaattctcaaagctgacggatcgg
tggcagaatgctgtccagggtgttcggcagaggaagggtgacgttgatgggctggtgagg
cagtggcaagatttcactacttctgtggagaacttgtttcgcttcctcactgacaccagc
cacctgctatctgcagtgaagggccaggagcgcttcagcctctaccaaaccagaagtctg
atccatgagctgaagaataaagaaattcattttcaaaggaggcgaactacctgtgcccta
accttggaagctggagaaaagttactgctcacaactgacctgaaaactaaagagtctgtg
ggtaggagaatcagtcaacttcaggacagctggaaagacatggagccccagctggcagag
atgattaagcagttccagagcactgtagagacctgggaccagtgtgaaaagaaaatcaag
gagttgaaaagcaggctgcaagttttaaaggcacaaagtgaagatcctcttccagagctt
cacgaggacctccataacgaaaaagagctgattaaggaactagaacagtctttggctagc
tggactcagaacttgaaagaacttcaaactatgaaggcggacttaacccggcacgttctc
gtggaagatgtgatggttttgaaggagcaaatagagcatttgcacagacaatgggaggac
ctctgcttaagggtggccatacgtaaacaggagattgaagacagactcaatacatgggtt
gtattcaatgaaaaaaataaagagttgtgtgcctggctggtgcagatggaaaacaaagtt
ctacagacagcggacattagtattgaagaaatgattgaaaagttacagaaggactgcatg
gaagaaataaacttgtttagtgaaaacaagttacagttaaagcagatgggtgaccagttg
atcaaggccagcaacaaatcaagagcagctgagatcgatgacaagctcaacaaaattaac
gatcgttggcaacatctttttgatgtcatcggatcaagggtgaagaagctgaaggagacc
tttgcttttattcagcagttggacaaaaacatgagcaaccttcgcacctggttggctcga
attgagtctgagctttccaagcctgttgtttatgatgtctgcgatgatcaagagatccag
aagaggctcgctgagcagcaggatctacagcgagatattgaacaacacagcgcaggggtg
gagtccgtgtttaacatctgtgacgtcctactgcacgactccgatgcctgtgcaaatgag
accgagtgtgactcgatccagcagaccaccaggagcctggacagacgctggaggaacatt
tgtgccatgtccatggagcggcgcatgaaaatcgaggagacgtggcgcctgtggcagaag
tttttagacgactattctcgctttgaggactggctcaagtcagctgagaggacggcagcc
tgcccaaattcctcagaggtgttgtacacgagtgccaaagaggaactgaagaggtttgag
gcctttcagcggcagattcatgagcggctcactcagctggagctcatcaacaagcagtac
cggcggctggcccgggagaaccgcacagacacggccagcaggctgaagcagatggtccac
gagggcaaccagcgctgggacaaccttcagaggcgggtcacagccgtcctgcggagactc
aggcatttcaccaaccagagggaagaatttgagggcaccagggagagcattctggtgtgg
ctcacagagatggacctgcagctgaccaacgtggagcacttctcagagagtgacgccgat
gacaagatgcgccaactgaatggcttccaacaggaaattacattaaataccaacaagatt
gatcagctcattgtgtttggggagcagctgattcagaagagcgagcccctggatgctgtg
ctgattgaggatgagctggaggaactccaccgctactgccaggaggtgtttggaagggtc
tcccggttccaccggcggctcacctcctgcactccgggcttggaagatgaaaaggaggcc
tctgagaatgaaacagacatggaagaccccagagaaatccagactgattcttggcgtaaa
cggggagagagcgaggaaccgtcatctcctcagtccctgtgtcatctagtggccccaggg
cacgagcggtctggctgcgagacccctgtcagcgtggactccatccccctggagtgggac
cacacaggcgacgtggggggctcctcctctcacgaagaggacgaggagggcccatactac
agcgcactgtcaggtaaatccatttcggatggccactcgtggcatgttcccgacagccct
tcctgtcccgagcatcactacaagcaaatggaaggtgacaggaatgttccacctgttccc
cctgcgtccagcaccccttataaaccaccctatggaaagctactattacctccaggcacg
gatggtggcaaagaaggcccgcgagtcctgaatggcaacccacagcaggaagacggggga
ctggccggtatcacagagcagcagtcaggtgccttcgacagatgggagatgattcaagca
caggagcttcacaataagctcaaaataaaacaaaatttgcaacagctgaactctgatatc
agcgccatcactacttggctgaaaaaaactgaagcagagctggaaatgttaaagatggca
aagcctccctctgatatccaggaaatagaactgagagtgaagagactgcaggagatactg
aaagcctttgacacttacaaggcattagtggtctctgtcaacgtgagcagcaaggaattt
ctgcaaaccgagagccccgaatccacagagctccaaagtagactccgccagctgagcctg
ctctgggaagcagcacagggcgcagtggacagctggagagggggcttacgacagtcgctc
atgcagtgccaggacttccaccagttgagtcaaaatctgctgctgtggttagcgagtgcc
aagaaccggaggcagaaggctcatgtcaccgatccaaaggcagacccccgggctctccta
gagtgtcggagggaactaatgcaactggaaaaggagctggtagaacgtcaacctcaagtg
gacatgttacaggagatttcaaacagccttctcattaagggacatggagaagactgtatt
gaagctgaagaaaaggtgcatgttattgagaagaaactcaaacagttacgggagcaagtg
tcccaagatttaatggccttgcagggaacccagaacccagcctcacccctgcccagcttc
gacgaggtagactcgggggaccagcctcctgcaacatccgtgccagctccccgagcaaag
cagttcagagcagtgagaactacagaaggcgaggaggagacagagagcagggtccccggc
agcacacggccacagcgctccttcctctcaagggtggtccgggcagccctacccctgcag
ctgctcctcctgctgctgctgctcctggcctgcctgctgccctcctccgaagaagactac
agctgcactcaggccaacaactttgcccggtccttttaccccatgctgaggtacaccaat
gggccaccccccacatag

DBGET integrated database retrieval system