KEGG   Homo sapiens (human): 23225
Entry
23225             CDS       T01001                                 

Gene name
NUP210, GP210, POM210
Definition
(RefSeq) nucleoporin 210
  KO
K14314  nuclear pore complex protein Nup210
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    23225 (NUP210)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23225 (NUP210)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23225 (NUP210)
SSDB
Motif
Pfam: Big_2
Other DBs
NCBI-GeneID: 23225
NCBI-ProteinID: NP_079199
OMIM: 607703
HGNC: 30052
Ensembl: ENSG00000132182
Vega: OTTHUMG00000157268
Pharos: Q8TEM1(Tbio)
UniProt: Q8TEM1
Position
3p25.1
AA seq 1887 aa
MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWLSTR
PEVASIEPLGLDEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHDIQ
IVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLIL
ENILLNPAYDVYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPV
AVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPGDRWVL
ETGRLYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVLSSSQNGSYHRIRALKRGQTA
IDAALTSVVDQDGGVHILQVPVWNQQEVEIHIPITLYPSILTFPWQPKTGAYQYTIRAHG
GSGNFSWSSSSHLVATVTVKGVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEF
APCQVEARVGQALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPP
GSEHCSGIRVKAEAQGSTTLLVSYRHGHVHLSAKITIAAYLPLKAVDPSSVALVTLGSSK
EMLFEGGPRPWILEPSKFFQNVTAEDTDSIGLALFAPHSSRNYQQHWILVTCQALGEQVI
ALSVGNKPSLTNPFPAVEPAVVKFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQVVPVS
SHRNPRLDLAAYDQEGRRFDNFSSLSIQWESTRPVLASIEPELPMQLVSQDDESGQKKLH
GLQAILVHEASGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPE
EVTIYNHPGIQAELRIREGSGYFFLNTSTADVVKVAYQEARGVAMVHPLLPGSSTIMIHD
LCLVFPAPAKAVVYVSDIQELYIRVVDKVEIGKTVKAYVRVLDLHKKPFLAKYFPFMDLK
LRAASPIITLVALDEALDNYTITFLIRGVAIGQTSLTASVTNKAGQRINSAPQQIEVFPP
FRLMPRKVTLLIGATMQVTSEGGPQPQSNILFSISNESVALVSAAGLVQGLAIGNGTVSG
LVQAVDAETGKVVIISQDLVQVEVLLLRAVRIRAPIMRMRTGTQMPIYVTGITNHQNPFS
FGNAVPGLTFHWSVTKRDVLDLRGRHHEASIRLPSQYNFAMNVLGRVKGRTGLRVVVKAV
DPTSGQLYGLARELSDEIQVQVFEKLQLLNPEIEAEQILMSPNSYIKLQTNRDGAASLSY
RVLDGPEKVPVVHVDEKGFLASGSMIGTSTIEVIAQEPFGANQTIIVAVKVSPVSYLRVS
MSPVLHTQNKEALVAVPLGMTVTFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPT
NNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTS
LEGLSGTWSSSANSILHIDPKTGVAVARAVGSVTVYYEVAGHLRTYKEVVVSVPQRIMAR
HLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVF
DFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQ
VGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFG
WPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLF
QHFLDSYQVMFFTLFALLAGTAVMIIAYHTVCTPRDLAVPAALTPRASPGHSPHYFAASS
PTSPNALPPARKASPPSGLWSPAYASH
NT seq 5664 nt   +upstreamnt  +downstreamnt
atggcggcgcggggccgggggctgctgctgctgacgctgtcggtgctgttggcggcgggc
ccctccgccgctgcggccaagctcaacatccccaaagtgctgctgcccttcacgcgggcc
acgcgcgttaacttcacgctggaggcctcggagggctgctaccgctggttgtccacccgg
ccggaggtggccagcatcgagccgctgggcctggacgagcagcagtgctcccagaaggca
gtggtgcaggcccgcctgacccagcctgcccgcctcaccagcatcatcttcgcagaggac
atcaccacaggccaggtcctgcgctgtgatgccattgtggacctcatccatgacatccag
atcgtctccaccacccgcgagctctacctggaggactcccccctggagctgaagatccag
gccctggactccgaagggaacaccttcagcactctggctggactggtcttcgagtggacg
attgtgaaggactccgaggcggacaggttctcagactcccacaatgcgctgcgaatcctc
actttcttggagtctacgtacatccctccttcttacatctcagagatggagaaggctgcc
aagcaaggggacaccatcctggtgtctgggatgaagaccgggagctccaagctcaaggct
cgcatccaggaggctgtctacaagaatgtacgccctgcagaagtcaggctgctgattttg
gaaaacatccttctgaacccggcctatgacgtctacctgatggtgggaacctccattcac
tacaaggtgcagaagatcaggcaagggaaaattacagaactctccatgccttccgatcag
tacgagttgcagcttcagaacagcatcccgggccccgaaggagacccagcccggccggtg
gctgtcttggcccaggacacgtcgatggtcactgcactgcagctgggacagagcagcctc
gtccttggccacaggagtattcgcatgcaaggtgcttctaggttacccaacagcactatc
tacgtggtcgaacctggatacctagggttcactgttcaccctggtgacaggtgggtgctg
gagaccggccgcctgtatgaaatcaccatcgaagtttttgacaagttcagcaacaaggtc
tatgtatctgacaacatccgaattgaaactgtgcttcctgctgagttcttcgaggtgctc
tcgtcctcccagaatgggtcataccatcgcatcagggcactaaagaggggacagacggcc
attgacgcggccctcacctctgtggtggaccaggatggaggggtccacatactacaggtg
cctgtgtggaaccagcaggaggtggaaattcacatcccgatcaccctgtatcccagcatc
ttgacatttccgtggcaaccaaagacgggcgcctatcagtacacaataagggcccacggt
ggcagtgggaacttcagctggtcttcgtcaagccacctggttgccacagttactgtcaag
ggcgtgatgaccacaggcagtgacatcgggttcagtgtgatccaggcacatgatgtgcag
aacccactccatttcggtgagatgaaggtgtatgtgatcgagccccacagcatggagttt
gccccgtgccaggtggaggcacgtgtgggccaggccctggagctgcccctgaggatcagt
ggcctcatgcccggcggggccagtgaggtggtcaccttgagcgactgctcccactttgac
ttggctgtcgaggtggagaaccagggtgtgttccagccactcccagggaggctgccgcca
ggctctgagcactgcagcggcatccgggtaaaggccgaggcccagggctctaccacgctt
cttgtgagctacagacacggccacgtccacctgagtgccaagatcaccattgctgcctac
ctgcccctcaaggctgtggatccctcctctgttgccttggtaaccctgggctcctcaaag
gagatgctgtttgaaggaggtcccagaccttggatcctcgagccgtccaaattcttccag
aacgtcaccgctgaggacactgacagcatcggcctggctctctttgccccccattcctcc
cggaattatcagcaacactggatccttgtgacctgtcaggccttgggtgagcaggtcatc
gccctgtcggtggggaacaagcccagcctcaccaacccctttcctgcggtggagcctgcc
gtggtgaagttcgtctgcgccccaccgtccaggctcaccctcgcgcctgtctacaccagc
ccccagctggacatgtcctgtccgctgctgcagcagaacaagcaggtggtcccagtgtcc
agccaccgcaacccccggctggacctggctgcttacgaccaggagggccgccggttcgac
aacttcagctctctgagcatccagtgggagtccaccaggccagtgttggccagcatcgag
cctgagctgcccatgcagctggtgtcccaggacgatgagagtggccaaaagaagctgcac
ggtttgcaggccattttggttcacgaggcatcaggaaccacagccatcactgccactgcc
actggctaccaggagtcccacctcagctctgccagaacaaagcagccgcatgaccctctg
gtgcctctgtcggcctccatagagctcatcctggtggaggacgtgagggtgagcccagaa
gaggtgaccatctacaaccaccctggcatccaggcagagctccgcatcagggaaggctca
ggttacttcttcctcaacaccagcaccgcagatgttgtcaaggtggcctaccaggaggcc
aggggtgtcgccatggtgcaccctttgctcccgggctcatccaccatcatgatccatgac
ttgtgcctcgtcttcccggccccagccaaggctgtcgtttacgtgtcggacattcaggag
ctgtacatccgtgtggttgacaaggtggagattgggaagacagtgaaggcatacgtccgc
gtgctggacttgcacaagaagcccttccttgccaaatacttcccctttatggacctgaag
ctccgagcagcctccccgatcattacattggtggcccttgatgaagcccttgacaactac
accatcacattcctcatccgcggtgtggccatcggccagaccagtctaactgcaagtgtg
accaataaagctggacagagaatcaactcagccccacaacagattgaagtctttcccccg
ttcaggctgatgcccaggaaggtgacactgcttatcggggccacgatgcaggtcacctcc
gagggcggcccccagcctcagtccaacatccttttctccatcagcaatgagagcgttgcg
ctggtgagcgctgctgggctggtacagggcctcgccatcgggaacggcactgtgtctggg
ctcgtgcaggcagtggatgcagagaccggcaaggtggtcatcatctctcaggacctcgtg
caggtggaggtgctgctgctaagggccgtgaggatccgcgcccccatcatgcggatgagg
acgggcacccagatgcccatctatgtcaccggcatcaccaaccaccagaaccctttctcc
tttggcaatgccgtgccaggcctgaccttccactggtctgtcaccaagcgggacgtcctg
gacctccgagggcggcaccacgaggcgtcgatccgactcccgtcacagtacaactttgcc
atgaacgtgctcggccgggtaaaaggccggaccgggctgagggtggtggtcaaggctgtg
gaccccacatcggggcagctgtatggcctggccagagaactctcggatgagatccaagtc
caggtgtttgagaagctgcagctgctcaaccctgaaatagaagcagaacaaatattaatg
tcgcccaactcatatataaagctgcagacaaacagggatggtgcagcctctctgagctac
cgcgtcctggatggacccgaaaaggttccagttgtgcatgttgatgagaaaggctttcta
gcatcagggtctatgatcgggacatccaccatcgaagtgattgcacaagagccctttggg
gccaaccaaaccatcattgttgctgtaaaggtatcccctgtttcctacctgagggtttcc
atgagccctgtcctgcacacccagaacaaggaggccctggtggccgtgcctttgggaatg
accgtgaccttcactgtccacttccacgacaactctggagatgtcttccatgctcacagt
tcggtcctcaactttgccactaacagagacgactttgtgcagatcgggaagggccccacc
aacaacacctgcgttgtccgcacagtcagcgtgggcctgacactgctccgtgtgtgggac
gcagagcacccgggcctctcggacttcatgcccctgcctgtcctacaggccatctcccca
gagctgtctggggccatggtggtgggggacgtgctctgtctggccactgttctgaccagc
ctggaaggcctctcaggaacctggagctcctcggccaacagcatcctccacatcgacccc
aagacgggtgtggctgtggcccgggccgtgggatccgtgacggtttactatgaggtcgct
gggcacctgaggacctacaaggaggtggtggtcagcgtccctcagaggatcatggcccgt
cacctccaccccatccagaccagcttccaggaggctacagcctccaaagtgattgttgcc
gtgggagacagaagctctaacctgagaggcgagtgcacccccacccagagggaagtcatc
caggccttgcacccagagaccctcatcagctgccagtcccagttcaagccggccgtcttt
gatttcccatctcaagatgtgttcaccgtggagccacagtttgacactgctctcggccag
tacttctgctcaatcacaatgcacaggctgacggacaagcagcggaagcacctgagcatg
aagaagacagctctggtggtcagtgcctccctctccagcagccacttctccacagagcag
gtgggggccgaggtgcccttcagcccaggtctcttcgccgaccaggctgaaatccttttg
agcaaccactacaccagttccgagatcagggtctttggtgccccggaggttctggagaac
ttggaggtgaaatccgggtccccggccgtgctggcattcgcaaaggagaagtcttttggg
tggcccagcttcatcacatacacggtcggcgtcttggaccccgcggctggcagccaaggg
cctctgtccactaccctgaccttctccagccccgtgaccaaccaagccattgccatccca
gtgacagtggcttttgtggtggatcgccgtgggcccggtccttatggagccagcctcttc
cagcacttcctggattcctaccaggtcatgttcttcacgctcttcgccctgttggctggg
acagcggtcatgatcatagcctaccacactgtctgcacgccccgggatcttgctgtgcct
gcagccctcacgcctcgagccagccctggacacagcccccactatttcgctgcctcatca
cccacatctcccaatgcattgcctcctgctcgcaaagccagccctccctcagggctgtgg
agcccagcctatgcctcccactag

DBGET integrated database retrieval system