KEGG   Homo sapiens (human): 23236Help
Entry
23236             CDS       T01001                                 

Gene name
PLCB1, EIEE12, PI-PLC, PLC-154, PLC-I, PLC-beta-1, PLC154, PLCB1A, PLCB1B
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing's syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer's disease
hsa05016  Huntington's disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
H01815  Malignant migrating partial seizures in infancy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23236 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    23236 (PLCB1)
   04310 Wnt signaling pathway
    23236 (PLCB1)
   04371 Apelin signaling pathway
    23236 (PLCB1)
   04020 Calcium signaling pathway
    23236 (PLCB1)
   04070 Phosphatidylinositol signaling system
    23236 (PLCB1)
   04072 Phospholipase D signaling pathway
    23236 (PLCB1)
   04071 Sphingolipid signaling pathway
    23236 (PLCB1)
   04022 cGMP - PKG signaling pathway
    23236 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    23236 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23236 (PLCB1)
   04621 NOD-like receptor signaling pathway
    23236 (PLCB1)
   04062 Chemokine signaling pathway
    23236 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    23236 (PLCB1)
   04922 Glucagon signaling pathway
    23236 (PLCB1)
   04912 GnRH signaling pathway
    23236 (PLCB1)
   04915 Estrogen signaling pathway
    23236 (PLCB1)
   04921 Oxytocin signaling pathway
    23236 (PLCB1)
   04926 Relaxin signaling pathway
    23236 (PLCB1)
   04918 Thyroid hormone synthesis
    23236 (PLCB1)
   04919 Thyroid hormone signaling pathway
    23236 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    23236 (PLCB1)
   04916 Melanogenesis
    23236 (PLCB1)
   04924 Renin secretion
    23236 (PLCB1)
   04925 Aldosterone synthesis and secretion
    23236 (PLCB1)
   04927 Cortisol synthesis and secretion
    23236 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23236 (PLCB1)
   04270 Vascular smooth muscle contraction
    23236 (PLCB1)
  Digestive system
   04970 Salivary secretion
    23236 (PLCB1)
   04971 Gastric acid secretion
    23236 (PLCB1)
   04972 Pancreatic secretion
    23236 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    23236 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    23236 (PLCB1)
   04725 Cholinergic synapse
    23236 (PLCB1)
   04728 Dopaminergic synapse
    23236 (PLCB1)
   04726 Serotonergic synapse
    23236 (PLCB1)
   04720 Long-term potentiation
    23236 (PLCB1)
   04730 Long-term depression
    23236 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    23236 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    23236 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    23236 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23236 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23236 (PLCB1)
   05016 Huntington's disease
    23236 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    23236 (PLCB1)
   04934 Cushing's syndrome
    23236 (PLCB1)
  Infectious diseases
   05163 Human cytomegalovirus infection
    23236 (PLCB1)
   05146 Amoebiasis
    23236 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    23236 (PLCB1)
   05143 African trypanosomiasis
    23236 (PLCB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     23236 (PLCB1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    23236 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    23236 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 23236
NCBI-ProteinID: NP_056007
OMIM: 607120
HGNC: 15917
Ensembl: ENSG00000182621
Vega: OTTHUMG00000031849
Pharos: Q9NQ66(Tbio)
UniProt: Q9NQ66
Position
20p12.3
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gatcggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgcaaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtagat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagccgctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgctctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

DBGET integrated database retrieval system