KEGG   Homo sapiens (human): 23237Help
Entry
23237             CDS       T01001                                 

Gene name
ARC, Arg3.1, hArc
Definition
(RefSeq) activity regulated cytoskeleton associated protein
  KO
K15867  activity-regulated cytoskeleton-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    23237 (ARC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Retrotrans_gag DUF842 DUF3583
Motif
Other DBs
NCBI-GeneID: 23237
NCBI-ProteinID: NP_056008
OMIM: 612461
HGNC: 648
Ensembl: ENSG00000198576
Vega: OTTHUMG00000134310
Pharos: Q7LC44(Tbio)
UniProt: Q7LC44
Position
8q24.3
AA seq 396 aa AA seqDB search
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE
QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccaccggaccagcggcgggctccacgcctaccccgggccgcggggcggg
caggtggccaagcccaacgtgatcctgcagatcgggaagtgccgggccgagatgctggag
cacgtgcggcggacgcaccggcacctgctggccgaggtgtccaagcaggtggagcgcgag
ctgaaggggctgcaccggtcggtcgggaagctggagagcaacctggacggctacgtgccc
acgagcgactcgcagcgctggaagaagtccatcaaggcctgcctgtgccgctgccaggag
accatcgccaacctggagcgctgggtcaagcgcgagatgcacgtgtggcgcgaggtgttc
taccgcctggagcgctgggccgaccgcctggagtccacgggcggcaagtacccggtgggc
agcgagtcagcccgccacaccgtttccgtgggcgtggggggtcccgagagctactgccac
gaggcagacggctacgactacaccgtcagcccctacgccatcaccccgcccccagccgct
ggcgagctgcccgggcaggagcccgccgaggcccagcagtaccagccgtgggtccccggc
gaggacgggcagcccagccccggcgtggacacgcagatcttcgaggaccctcgagagttc
ctgagccacctagaggagtacttgcggcaggtgggcggctctgaggagtactggctgtcc
cagatccagaatcacatgaacgggccggccaagaagtggtgggagttcaagcagggctcc
gtgaagaactgggtggagttcaagaaggagttcctgcagtacagcgagggcacgctgtcc
cgagaggccatccagcgcgagctggacctgccgcagaagcagggcgagccgctggaccag
ttcctgtggcgcaagcgggacctgtaccagacgctctacgtggacgcggacgaggaggag
atcatccagtacgtggtgggcaccctgcagcccaagctcaagcgtttcctgcgccacccc
ctgcccaagaccctggagcagctcatccagaggggcatggaggtgcaggatgacctggag
caggcggccgagccggccggcccccacctcccggtggaggatgaggcggagaccctcacg
cccgcccccaacagcgagtccgtggccagtgaccggacccagcccgagtag

DBGET integrated database retrieval system