KEGG   Homo sapiens (human): 2324Help
Entry
2324              CDS       T01001                                 

Gene name
FLT4, FLT-4, FLT41, LMPH1A, LMPHM1, PCL, VEGFR-3, VEGFR3
Definition
(RefSeq) fms related tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H00535  Hereditary lymphedema
H01471  Lymphangioma
Drug target
Axitinib: D03218
Cabozantinib (DG01670): D10062 D10095
Cediranib (DG01360): D08881 D08883
Dovitinib lactate: D08907
Lenvatinib (DG01362): D09919 D09920
Linifanib: D09635
Motesanib (DG01262): D06678 D08947
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Sitravatinib (DG03045): D11140 D11541
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tivozanib (DG01375): D09683 D10190
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2324 (FLT4)
   04015 Rap1 signaling pathway
    2324 (FLT4)
   04010 MAPK signaling pathway
    2324 (FLT4)
   04151 PI3K-Akt signaling pathway
    2324 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2324 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2324 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    2324 (FLT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2324 (FLT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2324 (FLT4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   2324 (FLT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Ig_2 Pkinase ig VEGFR-2_TMD V-set C1-set Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2324
NCBI-ProteinID: NP_891555
OMIM: 136352
HGNC: 3767
Ensembl: ENSG00000037280
Vega: OTTHUMG00000130931
Pharos: P35916(Tclin)
UniProt: P35916
Structure
PDB: 

Position
5q35.3
AA seq 1363 aa AA seqDB search
MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRR
RPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggggcgccgcgctgtgcctgcgactgtggctctgcctgggactcctggacggc
ctggtgagtggctactccatgacccccccgaccttgaacatcacggaggagtcacacgtc
atcgacaccggtgacagcctgtccatctcctgcaggggacagcaccccctcgagtgggct
tggccaggagctcaggaggcgccagccaccggagacaaggacagcgaggacacgggggtg
gtgcgagactgcgagggcacagacgccaggccctactgcaaggtgttgctgctgcacgag
gtacatgccaacgacacaggcagctacgtctgctactacaagtacatcaaggcacgcatc
gagggcaccacggccgccagctcctacgtgttcgtgagagactttgagcagccattcatc
aacaagcctgacacgctcttggtcaacaggaaggacgccatgtgggtgccctgtctggtg
tccatccccggcctcaatgtcacgctgcgctcgcaaagctcggtgctgtggccagacggg
caggaggtggtgtgggatgaccggcggggcatgctcgtgtccacgccactgctgcacgat
gccctgtacctgcagtgcgagaccacctggggagaccaggacttcctttccaaccccttc
ctggtgcacatcacaggcaacgagctctatgacatccagctgttgcccaggaagtcgctg
gagctgctggtaggggagaagctggtcctgaactgcaccgtgtgggctgagtttaactca
ggtgtcacctttgactgggactacccagggaagcaggcagagcggggtaagtgggtgccc
gagcgacgctcccagcagacccacacagaactctccagcatcctgaccatccacaacgtc
agccagcacgacctgggctcgtatgtgtgcaaggccaacaacggcatccagcgatttcgg
gagagcaccgaggtcattgtgcatgaaaatcccttcatcagcgtcgagtggctcaaagga
cccatcctggaggccacggcaggagacgagctggtgaagctgcccgtgaagctggcagcg
taccccccgcccgagttccagtggtacaaggatggaaaggcactgtccgggcgccacagt
ccacatgccctggtgctcaaggaggtgacagaggccagcacaggcacctacaccctcgcc
ctgtggaactccgctgctggcctgaggcgcaacatcagcctggagctggtggtgaatgtg
cccccccagatacatgagaaggaggcctcctcccccagcatctactcgcgtcacagccgc
caggccctcacctgcacggcctacggggtgcccctgcctctcagcatccagtggcactgg
cggccctggacaccctgcaagatgtttgcccagcgtagtctccggcggcggcagcagcaa
gacctcatgccacagtgccgtgactggagggcggtgaccacgcaggatgccgtgaacccc
atcgagagcctggacacctggaccgagtttgtggagggaaagaataagactgtgagcaag
ctggtgatccagaatgccaacgtgtctgccatgtacaagtgtgtggtctccaacaaggtg
ggccaggatgagcggctcatctacttctatgtgaccaccatccccgacggcttcaccatc
gaatccaagccatccgaggagctactagagggccagccggtgctcctgagctgccaagcc
gacagctacaagtacgagcatctgcgctggtaccgcctcaacctgtccacgctgcacgat
gcgcacgggaacccgcttctgctcgactgcaagaacgtgcatctgttcgccacccctctg
gccgccagcctggaggaggtggcacctggggcgcgccacgccacgctcagcctgagtatc
ccccgcgtcgcgcccgagcacgagggccactatgtgtgcgaagtgcaagaccggcgcagc
catgacaagcactgccacaagaagtacctgtcggtgcaggccctggaagcccctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagcgactcgctggagatgcagtgcttg
gtggccggagcgcacgcgcccagcatcgtgtggtacaaagacgagaggctgctggaggaa
aagtctggagtcgacttggcggactccaaccagaagctgagcatccagcgcgtgcgcgag
gaggatgcgggacgctatctgtgcagcgtgtgcaacgccaagggctgcgtcaactcctcc
gccagcgtggccgtggaaggctccgaggataagggcagcatggagatcgtgatccttgtc
ggtaccggcgtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
aggaggccggcccacgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctctggaggagcaatgcgaatacctgtcctacgatgccagccagtgggaattc
ccccgagagcggctgcacctggggagagtgctcggctacggcgccttcgggaaggtggtg
gaagcctccgctttcggcatccacaagggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacggccagcgagcaccgcgcgctgatgtcggagctcaagatcctc
attcacatcggcaaccacctcaacgtggtcaacctcctcggggcgtgcaccaagccgcag
ggccccctcatggtgatcgtggagttctgcaagtacggcaacctctccaacttcctgcgc
gccaagcgggacgccttcagcccctgcgcggagaagtctcccgagcagcgcggacgcttc
cgcgccatggtggagctcgccaggctggatcggaggcggccggggagcagcgacagggtc
ctcttcgcgcggttctcgaagaccgagggcggagcgaggcgggcttctccagaccaagaa
gctgaggacctgtggctgagcccgctgaccatggaagatcttgtctgctacagcttccag
gtggccagagggatggagttcctggcttcccgaaagtgcatccacagagacctggctgct
cggaacattctgctgtcggaaagcgacgtggtgaagatctgtgactttggccttgcccgg
gacatctacaaagaccccgactacgtccgcaagggcagtgcccggctgcccctgaagtgg
atggcccctgaaagcatcttcgacaaggtgtacaccacgcagagtgacgtgtggtccttt
ggggtgcttctctgggagatcttctctctgggggcctccccgtaccctggggtgcagatc
aatgaggagttctgccagcggctgagagacggcacaaggatgagggccccggagctggcc
actcccgccatacgccgcatcatgctgaactgctggtccggagaccccaaggcgagacct
gcattctcggagctggtggagatcctgggggacctgctccagggcaggggcctgcaagag
gaagaggaggtctgcatggccccgcgcagctctcagagctcagaagagggcagcttctcg
caggtgtccaccatggccctacacatcgcccaggctgacgctgaggacagcccgccaagc
ctgcagcgccacagcctggccgccaggtattacaactgggtgtcctttcccgggtgcctg
gccagaggggctgagacccgtggttcctccaggatgaagacatttgaggaattccccatg
accccaacgacctacaaaggctctgtggacaaccagacagacagtgggatggtgctggcc
tcggaggagtttgagcagatagagagcaggcatagacaagaaagcggcttcagctgtaaa
ggacctggccagaatgtggctgtgaccagggcacaccctgactcccaagggaggcggcgg
cggcctgagcggggggcccgaggaggccaggtgttttacaacagcgagtatggggagctg
tcggagccaagcgaggaggaccactgctccccgtctgcccgcgtgactttcttcacagac
aacagctactaa

DBGET integrated database retrieval system