KEGG   Homo sapiens (human): 23244Help
Entry
23244             CDS       T01001                                 

Gene name
PDS5A, PIG54, SCC-112, SCC112
Definition
(RefSeq) PDS5 cohesin associated factor A
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23244 (PDS5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Adherin complex
    23244 (PDS5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 23244
NCBI-ProteinID: NP_001093869
OMIM: 613200
HGNC: 29088
Ensembl: ENSG00000121892
Vega: OTTHUMG00000160582
Pharos: Q29RF7(Tbio)
UniProt: Q29RF7 G1UI16
Position
4p14
AA seq 1337 aa AA seqDB search
MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSE
DEKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFI
TRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHN
KKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIE
ACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERL
AVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKD
LTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMM
GLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLET
EERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLM
TIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANP
KQPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDTAIRSGL
ELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTL
IPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVPEQLITPLVSL
GHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIK
LLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLA
QEPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDP
VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQD
VDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCD
VALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGV
LGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEEN
PVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDES
GPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQ
DLAKKAAPAERQIDLQR
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaccgcgcagcccaagcctgccactgccctctgtggcgtcgtgagtgccgac
gggaagatcgcttaccctccgggggtaaaagagatcaccgacaagatcaccacggacgag
atgatcaaacgcctgaagatggtagtgaaaacctttatggatatggatcaggactcagaa
gatgaaaaacagcagtatctcccactagccttgcatcttgcatctgaattcttcctcagg
aaccccaataaagatgtgcgtctccttgtagcatgttgtttggctgatatctttcgtatc
tatgccccagaagctccatatacttcccatgataaacttaaggacatatttttgtttatt
accagacaattaaaaggtttggaggatacaaagagtccacagtttaatagatacttttat
ttattagagaatttagcttgggttaaatcatataacatctgctttgaattggaagattgc
aatgaaatttttattcagctttttagaactctcttctcagtgatcaacaatagccacaat
aagaaggtacaaatgcacatgctagatttgatgagttctatcatcatggaaggtgatgga
gttactcaagaattattggactccattcttattaacctcattcctgcacataagaactta
aataaacagtcctttgaccttgcaaaagtgctattgaaaagaacagtccagactattgag
gcatgcattgctaattttttcaatcaagtcctggtgctgggaagatcatcagtaagtgat
ttgtcagaacatgtatttgatctgattcaggaactttttgctatagatcctcatttatta
ttatccgtcatgccacagcttgaattcaaactaaagagcaatgatggagaagagcgatta
gctgttgttcgacttctagctaaattgtttggctccaaagattctgatttggcaacacag
aatcgtcctctttggcaatgttttcttggacgatttaatgatattcatgttcctgtgaga
ttagaaagtgtgaaatttgccagtcattgtttaatgaatcacccagatttagcgaaggat
ctcacagaatatttaaaggttagatcacatgatccagaagaagctattcgtcatgatgtc
attgttactataataacagctgccaagagggacctggccttagtaaatgatcagctgctt
ggctttgtaagggaaagaacactggataaacggtggcgagtaagaaaagaagctatgatg
ggtctggctcagctttataagaaatactgtcttcatggtgaagcaggaaaggaagctgca
gagaaagtcagctggataaaggacaaacttctgcatatttattatcagaacagcattgac
gacaaactgttggtagagaaaatctttgctcagtatcttgtcccccacaacctggaaaca
gaagagagaatgaaatgcttatattacttatatgctagtttggatccaaatgctgtaaaa
gctctcaacgaaatgtggaagtgtcagaacatgcttcggagccatgtacgcgaactattg
gatttgcacaagcagcctacatcagaggctaactgttctgccatgtttggaaaactgatg
accatagcaaagaatttgcctgaccccgggaaagcacaagattttgtgaagaaatttaac
caggttctcggcgatgatgagaaacttcggtctcagttggagttattaattagcccaacc
tgttcttgcaaacaagcagatatttgtgtgagagaaatagcccggaaacttgcaaatcct
aagcaaccaacaaatccttttctagagatggtcaaatttctgttggaaagaatcgcacct
gtgcacattgattcagaagccataagtgcactagtgaaattgatgaataagtcaatagag
gggacagcagatgatgaagaggagggtgtaagtccagatacagctatccgttcaggactt
gaacttcttaaggttctgtcttttacacatcctacctcgttccactctgcagagacatat
gagtccttgttacagtgcctaagaatggaggatgacaaggtagcagaagctgctattcaa
atttttagaaatacaggtcacaaaatagaaacagaccttccccagatacgatcgacctta
attcccattttacatcaaaaagcaaagaggggtactccacaccaagcaaaacaggctgtg
cactgtatacacgccatattcacaaataaagaagtccagcttgcacagatttttgagcca
ctcagtaggagtctgaatgctgatgtgccagaacaacttataactccattagtttcattg
ggccacatttctatgttagcaccagatcagtttgcttccccaatgaaatctgtagtagca
aattttattgtgaaagatctgctaatgaatgacaggtcaacaggtgaaaagaatggaaaa
ctgtggtctccagatgaagaggtttcccctgaagtactagcaaaggtacaggcaattaaa
cttctggtaaggtggctgttgggtatgaaaaacaaccagtctaaatctgccaattcaacc
cttcggttattatcagcgatgttggttagtgagggtgacctgacagagcaaaagaggatc
agtaaatctgatatgtctcgcttgcgattagctgctggtagtgccataatgaagcttgct
caggaaccttgttaccatgaaattattaccccagaacagtttcagctctgtgcacttgtt
attaatgatgagtgttaccaagtaaggcagatatttgctcagaagctgcataaggcactt
gtgaagttactgctcccattggagtatatggcgatctttgccttgtgtgccaaagatcct
gtgaaggagagaagagcacacgcacgacaatgtttactgaaaaatatcagtatacgcagg
gaatacattaagcagaatcctatggctactgagaaattattatcactgttgcctgaatat
gtagttccatacatgattcacctgctagcccatgatccagattttacaagatcacaagat
gttgatcagcttcgtgatatcaaagagtgcctatggttcatgcttgaagttttaatgaca
aagaatgaaaacaatagccatgcctttatgaagaagatggcagagaacatcaagttaacc
agagatgcccagtctccagatgaatccaagacaaatgaaaaactgtatacagtatgtgat
gtggctctctgtgttataaatagtaaaagtgctttgtgcaatgcagattcaccaaaggac
ccagtcctcccaatgaaattttttacacaacctgaaaaggacttctgtaacgataagagt
tatatttcagaagagacaagagtacttctgttaacaggaaagccaaagcctgctggagta
ctaggtgcagtaaataagcctttatcagcaacgggaaggaaaccctatgttagaagcact
ggcactgagactggaagcaatattaatgtaaattcagagctgaacccttcaaccggaaat
cgatcaagggaacagagttcagaggcagcagaaactggagttagtgaaaatgaagagaac
cctgtgaggattatttcagtcacacctgtaaagaatattgacccagtaaagaataaggaa
attaattctgatcaggctacccagggcaacatcagcagtgaccgaggaaagaaaagaaca
gtaacagcagctggtgcagagaatatccaacaaaaaacagatgagaaagtagatgaatcg
ggacctcccgccccttccaaacccaggagaggacgtcgacccaagtctgaatctcagggc
aatgctaccaaaaatgatgatctaaataaacctattaacaagggaaggaagagagctgca
gtgggtcaggagagccctgggggtttggaagcaggtaatgccaaagcacccaaactgcaa
gatttagccaaaaaggcagcaccagcagaaagacaaattgacttacaaaggtaa

DBGET integrated database retrieval system