KEGG   Homo sapiens (human): 23245Help
Entry
23245             CDS       T01001                                 

Gene name
ASTN2, bA67K19.1
Definition
(RefSeq) astrotactin 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin_like ASTN_2_hairpin FXa_inhibition MACPF cEGF Herpes_gE fn3
Motif
Other DBs
NCBI-GeneID: 23245
NCBI-ProteinID: NP_054729
OMIM: 612856
HGNC: 17021
Ensembl: ENSG00000148219
Vega: OTTHUMG00000021013
Pharos: O75129(Tbio)
UniProt: O75129
Structure
PDB: 

Position
9q33.1
AA seq 1288 aa AA seqDB search
MAAAGARLSPGPGSGLRGRPRLCFHPGPPPLLPLLLLFLLLLPPPPLLAGATAAASREPD
SPCRLKTVTVSTLPALRESDIGWSGARAGAGAGTGAGAAAAAASPGSPGSAGTAAESRLL
LFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSS
GQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRRRIP
QKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDCEEDEE
PPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKGGISFGRAKGTSGSEADDETQL
TFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHF
IADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETG
ECSCHEGYAPDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTFSLGQ
GLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSFGP
VRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGC
EQLCLQQTLPLPYDATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFND
TLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSE
PLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSRE
ELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPF
ITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVV
PLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLR
LSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSG
LGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACP
LVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFV
WRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWY
SILKDTKITCEEKMVSMARNTYGESKGR
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccggcgcccggctcagccccggccccggctcggggctccgggggcggccg
aggctctgcttccacccggggccgccgccactgctgccgctgctgctgctgttcctgctc
ctgctgccgccgccgccgctgctggccggcgccaccgccgctgcctcgcgggagcccgac
agcccgtgccggctgaagaccgtcacggtgtccacactgcccgccctgcgggagagcgac
atcggctggagcggcgcccgcgccggggccggggctgggaccggggccggagccgccgcc
gccgccgcgtccccgggctctcctggctctgccggcaccgccgccgagtcgcgcctcctg
ctctttgtgcgtaacgagctgccggggcgcatcgcggtgcaggacgacctggacaacacc
gagctgcccttcttcaccctggagatgtctggcacagcggcggacatctcgctggtgcac
tggagacagcagtggctggagaatggcaccttgtacttccacgtctccatgagcagctcc
gggcagctggcccaagccaccgcccccactctccaggagccctcggagattgttgaggag
cagatgcacatcctccacatttctgtgatgggtggcctcatcgcgctgctgctgctgctg
ctggtgttcaccgtggcgctgtacgcccagcgacgttggcagaagcgtcgccgcatcccc
cagaagagcgcaagcacagaagccactcatgagatccactacatcccatctgtgctgctg
ggtccccaggcgcgggagagcttccgttcatcccggctgcaaacccacaattccgtcatt
ggcgtgcccatccgggagactcccatcctggatgactatgactgtgaggaggatgaggag
ccacctaggcgggccaaccatgtctcccgcgaggacgagtttggcagccaggtgacccac
actctggacagtctgggacatccaggggaagagaaggtggactttgagaagaaaggagga
atcagctttgggagagccaaggggacgtcgggctcagaggcagacgatgaaactcagctg
acattctacacggagcagtaccgcagtcgccgccgcagcaaaggtttgctgaaaagccca
gtgaacaagacagccctgacactgattgctgtgagttcctgcatcctggccatggtgtgt
ggcagccagatgtcttgtccactcactgtgaaggtgactctgcatgtgcccgagcacttc
atagcagatggaagcagcttcgtggtgagtgaagggagctacctggacatctccgactgg
ttaaacccggccaagctttccctgtattaccagatcaatgccacctccccatgggtgagg
gacctctgtggacaaaggacgacagatgcctgtgagcagctctgcgacccagaaaccgga
gagtgcagctgtcatgaaggctatgcccctgaccctgttcacagacacctgtgtgtgcgc
agtgactggggacagagtgaaggaccttggccctacacgacacttgagaggggctatgat
ctggtgacaggggagcaagcccctgaaaagattctcaggtctactttcagcttgggccaa
ggcctctggcttcctgtcagcaaaagctttgtggttccgcctgtggagctgtccatcaac
cccctggccagctgcaagaccgatgtgctcgtcacggaagaccctgcagatgtcagggaa
gaagcgatgctgtccacatactttgaaaccatcaatgacctgctgtcttccttcgggcca
gttcgtgactgctctcggaacaatgggggctgcactcgcaacttcaagtgtgtgtctgac
cggcaggtggattcctcgggatgtgtgtgccctgaggagctgaaacccatgaaggatggc
tctggctgctacgaccactccaaaggcattgactgctctgatggctttaatggcggctgt
gagcagctgtgcctgcagcagacgctgcccctgccctacgatgccacttcgagcaccatc
ttcatgttctgcggttgcgtggaggagtacaaactggctcctgatggaaaatcctgctta
atgctctcagatgtctgcgagggccccaagtgcctcaaacctgactccaaattcaatgat
accctctttggagagatgctacatggttacaacaaccggacccagcatgtgaaccaaggc
caagtcttccagatgacctttagggagaacaacttcatcaaggactttccccagctggcc
gatgggctgttggtgatcccgctgccggtggaggagcagtgccggggggtcctctccgag
ccccttccagacctccaactgctcactggagatatcaggtatgatgaggccatgggttac
cccatggtgcagcagtggcgggtccggagcaacctctaccgtgtgaagctcagcaccatc
accctcgcagcaggcttcactaatgttctcaagatcctgaccaaggagagcagtcgggag
gagctgctgtccttcatccagcactatggctcccactacatcgcagaggccctctatggc
tcagagctcacctgcatcatccactttcccagcaagaaggtccagcagcagctgtggctc
cagtatcagaaagagaccacagagctgggcagcaagaaggagctcaagtccatgcccttc
atcacctacctctcaggtttgctgacagcccagatgctgtcagatgaccagctcatttca
ggtgtggagattcgctgtgaggagaaggggcgctgtccatctacctgtcacctttgccgc
cggccaggcaaggagcagctgagccccacaccagtgctgctggaaatcaaccgtgtggtg
ccactttataccctcatccaagacaatggcacaaaggaggccttcaagagtgcactgatg
agttcctactggtgctcagggaaaggggatgtgatcgatgactggtgcaggtgtgacctc
agcgcctttgatgccaatgggctccccaactgcagcccccttctgcagccggtgctgcgg
ctgtccccaacagtggagccctccagtactgtggtctccttggagtgggtggatgttcag
ccagctattgggaccaaggtctccgactatattctgcagcataagaaagtggatgaatac
acagacactgacctgtacacaggagaattcctgagttttgctgatgacttactctctggc
ctgggcacatcttgtgtagcagctggtcgaagccatggagaggtccctgaagtcagtatc
tactcagtcatcttcaagtgtctggagcccgacggtctctacaagttcactctgtatgct
gtggatacacgagggaggcactcagagctaagcacggtgaccctgaggacggcctgtcca
ctggtagatgacaacaaggcagaagaaatagctgacaagatctacaatctgtacaatggg
tacacaagtggaaaggagcagcagatggcctacaacacactgatggaggtctcagcctcg
atgctgttccgagtccagcaccactacaactctcactatgaaaagtttggcgacttcgtc
tggagaagtgaggatgagctggggcccaggaaggcccacctgattctacggcgactggag
agggtgagtagccactgctccagcctcctgcggagtgcctacatccagagccgcgtggaa
acagtgccctatcttttctgccgcagcgaggaggtccggcctgcaggcatggtgtggtat
agcatcctcaaggacaccaaaatcacgtgtgaggagaagatggtgtcaatggcccgaaac
acgtacggggagtccaagggccggtga

DBGET integrated database retrieval system