KEGG   Homo sapiens (human): 23253
Entry
23253             CDS       T01001                                 
Symbol
ANKRD12, ANCO-2, ANCO1, GAC-1, Nbla00144
Name
(RefSeq) ankyrin repeat domain 12
  KO
K21436  ankyrin repeat domain-containing protein 11/12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23253 (ANKRD12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     23253 (ANKRD12)
SSDB
Motif
Pfam: Ank Ank_2 Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 23253
NCBI-ProteinID: NP_056023
OMIM: 610616
HGNC: 29135
Ensembl: ENSG00000101745
UniProt: Q6UB98
Position
18:9136781..9285985
AA seq 2062 aa
MPKSGFTKPIQSENSDSDSNMVEKPYGRKSKDKIASYSKTPKIERSDVSKEMKEKSSMKR
KLPFTISPSRNEERDSDTDSDPGHTSENWGERLISSYRTYSEKEGPEKKKTKKEAGNKKS
TPVSILFGYPLSERKQMALLMQMTARDNSPDSTPNHPSQTTPAQKKTPSSSSRQKDKVNK
RNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFAGWTPLHEACNVGYYDVAKILIAA
GADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGNPFQANKHGERPVDVAETEELELLL
KREVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEKDSLICESKQILPSKTPLPSALDE
YEFKDDDDEEINKMIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSR
VLYSSTESSDEEALQNKKISTSCSVIPETSNSDMQTKKEYVVSGEHKQKGKVKRKLKNQN
KNKENQELKQEKEGKENTRITNLTVNTGLDCSEKTREEGNFRKSFSPKDDTSLHLFHIST
GKSPKHSCGLSEKQSTPLKQEHTKTCLSPGSSEMSLQPDLVRYDNTESEFLPESSSVKSC
KHKEKSKHQKDFHLEFGEKSNAKIKDEDHSPTFENSDCTLKKMDKEGKTLKKHKLKHKER
EKEKHKKEIEGEKEKYKTKDSAKELQRSVEFDREFWKENFFKSDETEDLFLNMEHESLTL
EKKSKLEKNIKDDKSTKEKHVSKERNFKEERDKIKKESEKSFREEKIKDLKEERENIPTD
KDSEFTSLGMSAIEESIGLHLVEKEIDIEKQEKHIKESKEKPEKRSQIKEKDIEKMERKT
FEKEKKIKHEHKSEKDKLDLSECVDKIKEKDKLYSHHTEKCHKEGEKSKNTAAIKKTDDR
EKSREKMDRKHDKEKPEKERHLAESKEKHLMEKKNKQSDNSEYSKSEKGKNKEKDRELDK
KEKSRDKESINITNSKHIQEEKKSSIVDGNKAQHEKPLSLKEKTKDEPLKTPDGKEKDKK
DKDIDRYKERDKHKDKIQINSLLKLKSEADKPKPKSSPASKDTRPKEKRLVNDDLMQTSF
ERMLSLKDLEIEQWHKKHKEKIKQKEKERLRNRNCLELKIKDKEKTKHTPTESKNKELTR
SKSSEVTDAYTKEKQPKDAVSNRSQSVDTKNVMTLGKSSFVSDNSLNRSPRSENEKPGLS
SRSVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAKSPALHE
RELDSLADLPERIKPPYANRLSTSHLRSSSVEDVKLIISEGRPTIEVRRCSMPSVICEHT
KQFQTISEESNQGSLLTVPGDTSPSPKPEVFSNVPERDLSNVSNIHSSFATSPTGASNSK
YVSADRNLIKNTAPVNTVMDSPVHLEPSSQVGVIQNKSWEMPVDRLETLSTRDFICPNSN
IPDQESSLQSFCNSENKVLKENADFLSLRQTELPGNSCAQDPASFMPPQQPCSFPSQSLS
DAESISKHMSLSYVANQEPGILQQKNAVQIISSALDTDNESTKDTENTFVLGDVQKTDAF
VPVYSDSTIQEASPNFEKAYTLPVLPSEKDFNGSDASTQLNTHYAFSKLTYKSSSGHEVE
NSTTDTQVISHEKENKLESLVLTHLSRCDSDLCEMNAGMPKGNLNEQDPKHCPESEKCLL
SIEDEESQQSILSSLENHSQQSTQPEMHKYGQLVKVELEENAEDDKTENQIPQRMTRNKA
NTMANQSKQILASCTLLSEKDSESSSPRGRIRLTEDDDPQIHHPRKRKVSRVPQPVQVSP
SLLQAKEKTQQSLAAIVDSLKLDEIQPYSSERANPYFEYLHIRKKIEEKRKLLCSVIPQA
PQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSLSDPLKELFRQQEVVRMKLRLQHSIE
REKLIVSNEQEVLRVHYRAARTLANQTLPFSACTVLLDAEVYNVPLDSQSDDSKTSVRDR
FNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAAALNAVQRLEWQLKLQELDPATYKSISI
YEIQEFYVPLVDVNDDFELTPI
NT seq 6189 nt   +upstreamnt  +downstreamnt
atgcccaaatctgggttcacaaaaccaattcagagtgaaaattctgacagtgacagcaat
atggtagagaaaccatatggaagaaagagtaaagacaagattgcatcctacagcaaaact
ccaaaaattgaacgaagtgatgtgagcaaggagatgaaagagaaatcatccatgaaacgt
aaacttccttttactattagcccatcaagaaatgaagaacgagattcagacacagattca
gatccaggacatacaagtgaaaattggggggagagacttatatcttcttacaggacatac
tcagagaaagaaggtccagaaaagaagaagacaaaaaaggaagctggaaataagaaatcc
acaccagttagcattctttttggttatccactctctgagcgaaaacagatggcacttctt
atgcagatgacagcaagagacaacagtccagattccacaccaaatcatccatcacaaaca
acgcctgcccaaaagaaaactcccagttcttcatctcgacagaaagataaagttaataaa
agaaatgaacgtggtgaaactcctttacacatggctgctattcgaggagatgtgaaacaa
gttaaagaattaataagtttaggggcaaatgtgaatgtgaaagattttgcaggttggaca
ccactgcatgaagcttgcaatgttggatattacgatgttgctaagatacttatagcagct
ggagcagatgttaacacacaaggattagatgatgacactccactccatgattctgctagt
agtgggcacagagatatagtaaagctgttacttcgtcacggtggaaatccatttcaagct
aataaacatggggagcgtccagtggatgtagcagaaacagaggagttggagttgctacta
aaaagagaggtgcctttatctgatgatgatgaaagttacacagattccgaagaggctcaa
tctgtaaatccttctagtgttgatgaaaatattgactctgaaacagagaaagactctctc
atctgtgaaagtaaacagatacttcccagtaaaacacctcttccatctgcccttgatgag
tatgagttcaaagatgatgatgatgaagaaattaataagatgattgatgataggcatatt
cttaggaaagaacaacgaaaagaaaatgaacctgaagcagaaaaaactcatttatttgca
aaacaggagaaagccttctatcctaaatcatttaaaagtaaaaaacaaaagccatctagg
gtcttatattcaagtactgaaagttctgatgaagaagctcttcagaataaaaagatttct
acttcatgttccgtcatccctgaaacatcaaattctgatatgcaaaccaaaaaggaatat
gtagtttcaggtgaacacaaacagaaaggcaaagttaaaagaaaattgaaaaatcagaat
aaaaataaagagaaccaagagctaaagcaagaaaaggaaggaaaagaaaatacaagaata
acaaacttgacagtaaatactggactagattgttcagaaaagaccagagaggaggggaac
tttaggaaatcttttagcccaaaagatgatacttcattacatttatttcatatttccact
ggtaaatctcccaaacattcttgtggattaagtgaaaaacagtcaacaccactaaaacaa
gaacatactaaaacatgtttatcaccaggaagttctgaaatgtcattacagcctgatctt
gttcggtatgataatacagaatctgaattcttgccagaaagttcaagtgtaaaatcttgt
aagcataaggaaaaaagcaaacatcagaaagatttccacttagaatttggtgaaaaatca
aatgccaaaataaaggatgaagatcatagtccaacatttgaaaattcagattgcacactg
aaaaaaatggataaagaaggtaaaacattaaaaaaacataaattgaagcataaagagagg
gaaaaagaaaagcataaaaaagaaattgaaggtgaaaaggaaaaatacaaaactaaggat
agtgccaaagaactgcagaggagtgtggaatttgatagagaattttggaaagagaatttt
tttaaaagtgatgaaactgaagatctctttttaaatatggaacatgaatccttaacatta
gaaaaaaaatcaaaattggaaaaaaacatcaaagatgataaatcaaccaaggaaaagcat
gtgtcaaaagagaggaactttaaagaggaacgagacaagattaaaaaggaaagcgagaaa
tcttttagggaggaaaaaataaaagatctaaaagaagagagagaaaacatacccacagat
aaagactcagaatttacttctttgggtatgagtgccattgaggaatctatagggcttcat
ttagtggaaaaggaaatagacattgaaaaacaagaaaagcatataaaggaaagtaaagaa
aaacctgagaagcgatctcaaattaaagaaaaggacattgagaagatggaaagaaaaacc
tttgaaaaagaaaagaagataaaacatgagcataagtcagaaaaagacaaattagatctt
agtgaatgtgttgataaaataaaagaaaaggacaagctatattcgcatcacacagaaaaa
tgccataaagaaggtgagaagagcaaaaatactgctgctattaaaaaaactgacgacaga
gagaaaagtagagaaaagatggataggaaacatgacaaagaaaagcctgaaaaagagagg
catctagcagaaagcaaagaaaagcacttgatggagaaaaaaaataaacaatcagataat
agtgaatacagtaaatcagaaaaaggcaaaaataaagaaaaagacagggagctagataaa
aaggaaaaatctagagataaagaaagtataaatataactaactccaaacacatacaggaa
gaaaaaaaatcaagtatagtagacggtaataaagcacaacatgaaaaacccttatccctt
aaagaaaaaacaaaagatgaacctttgaaaactccagatggaaaagaaaaagataaaaaa
gataaagatatagatagatacaaagaacgagacaaacataaagataaaattcaaataaat
agcttactcaaactaaaatctgaagcagataagcctaaacctaagtcatcaccagcatca
aaagatacccgacctaaagaaaagaggttagtgaatgatgatttaatgcagacaagtttt
gaacgaatgctaagccttaaagacctagaaatagaacagtggcacaaaaaacataaggaa
aaaattaagcaaaaagaaaaggaacggttgagaaaccgaaactgtttagaacttaaaata
aaagataaagaaaaaacaaagcatacaccaactgaatccaaaaataaagaacttactagg
tcaaagagttcagaagtgactgatgcatataccaaggagaaacaacctaaagatgctgta
agtaacagatcacaatctgttgacaccaaaaatgtaatgactttagggaagtcatctttt
gtttcagataatagcttaaacaggtctcctagatcagaaaatgaaaagccgggtctcagc
tccagatctgtatccatgatttctgttgctagttcagaagattcctgccatactacagtg
acaaccccaaggcctccagttgagtatgactctgactttatgttagagagttcagaatcc
caaatgtccttttcccagtcaccttttttgtcaattgccaaatctcctgctcttcatgaa
agggaattggacagcctggctgacttgccggagcggattaaaccaccatatgcaaacaga
ctttcaacatcccatcttaggtcatcttctgtagaagatgttaaactaattataagcgag
gggagacctaccatagaagttcgaagatgtagcatgccttctgtcatttgtgaacatacc
aaacaattccaaacaatatcagaagagagcaatcaaggtagcttattaactgtgccagga
gatactagtccttctcccaaacctgaggtattctcaaatgtgcctgaaagagacctttca
aatgtatctaacatacattccagttttgcaacttctccaactggagcttcaaacagcaag
tatgtttcagctgatagaaatctcatcaagaatactgccccagtgaacactgtaatggac
agtccagtgcatttagagccatctagtcaggttggtgtgatccagaataaatcatgggag
atgcctgttgatagactagagacattaagcaccagagactttatctgcccaaattctaac
atacctgatcaagaatcctctcttcagagtttttgtaattctgaaaataaggtattgaaa
gaaaatgctgattttttatccctgcgccagactgaactgccaggaaactcttgtgctcag
gatccggcatcctttatgcctccacagcagccttgctctttccccagccaatcactttca
gatgctgaatcgatttctaaacatatgtctttgtcatatgttgctaatcaagagccaggt
attttacaacaaaaaaatgcagttcagattattagttctgctttagatactgataatgaa
tctacaaaagatacagaaaatacttttgtcctaggagatgttcaaaaaacagatgccttt
gtcccagtgtactctgacagcactattcaagaagcatcaccaaactttgagaaagcttat
actttacctgtgttaccatcagaaaaggactttaatggaagtgatgcctctacccagcta
aatacacattatgcatttagcaaactaacttacaagtcttccagtggccatgaagttgag
aatagcacaactgatactcaggtcatttcacatgaaaaagaaaacaaactggagagtttg
gttttaactcatttgagtaggtgtgattctgatttatgtgaaatgaatgcagggatgcca
aaaggaaacctaaatgaacaagatccaaaacattgtcctgaaagtgaaaagtgtttgctt
tccatagaagatgaggaatctcaacaaagcattttatcaagtctggaaaaccattcacag
cagtcaactcaaccagaaatgcataaatatggtcagttagttaaagtagaattagaagaa
aatgccgaagatgataaaactgaaaaccaaatccctcaaagaatgactagaaacaaagca
aatacaatggcaaatcaaagcaaacagattcttgctagctgtacactattatcagaaaaa
gacagtgaatcctcatctcctagaggaagaataagattaactgaagatgacgatcctcaa
attcaccatccacggaaaaggaaagtgtcacgtgtacctcagcctgtgcaagtgagtccc
tctttactacaagcaaaagagaaaactcagcaatctctggcagccattgtagattctcta
aaactagatgagattcagccatacagttcagagagagcaaatccatattttgaatacttg
cacataaggaaaaaaatagaagaaaaacgcaaattactgtgtagtgtgattcctcaagca
cctcagtactatgacgaatatgtaacatttaacggatcatatctcctggatggaaacccc
ttaagcaagatttgtattcccacaattacaccaccaccttcactgtcagatccacttaaa
gagctttttcgacaacaggaagttgtaaggatgaaactacgtttgcaacacagtattgaa
agggaaaaactcattgtatccaacgaacaagaagttttgcgagttcattacagagctgca
agaacattggcaaatcaaacactgccatttagtgcttgtactgttttgctggatgccgaa
gtatacaatgtaccattggactctcagtctgatgacagtaaaacttctgtgagggatcgc
tttaatgcaagacaattcatgtcttggttacaagatgtggatgataaatttgacaaatta
aagacctgtcttttaatgaggcaacaacatgaagctgcggctttaaatgctgtccagagg
ttagaatggcagctcaaactccaggaacttgatcctgccacctataaatctatcagcatt
tacgaaatccaggagttttatgttccccttgttgatgttaacgacgactttgaattgact
cctatatag

DBGET integrated database retrieval system