KEGG   Homo sapiens (human): 23254
Entry
23254             CDS       T01001                                 

Gene name
KAZN, C1orf196, KAZ
Definition
(RefSeq) kazrin, periplakin interacting protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SAM_2 SAM_1 DUF148
Other DBs
NCBI-GeneID: 23254
NCBI-ProteinID: NP_963922
OMIM: 618301
HGNC: 29173
Ensembl: ENSG00000189337
Vega: OTTHUMG00000002042
Pharos: Q674X7(Tbio)
UniProt: Q674X7
Position
1p36.21
AA seq 775 aa
MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGGPGPGPGAAASASAAG
DSAATNMENPQLGAQVLLREEVSRLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATEL
RVQLAQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLESREEQLRDFIRNY
EQHRKESEDAVKALAKEKDLLEREKWELRRQAKEATDHATALRSQLDLKDNRMKELEAEL
AMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADLPLTAAIRQSQQTLYHSHPPH
PADRQAVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNGDSPGPVQKNL
HNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDDSDSQCSPTRQSL
SLSEGEEQMDRLQQVELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACTENVKSGKVLLS
LSDEDLQLGLGVCSSLHRRKLRLAIEDYRDAEAGRSLSKAAELDHHWVAKAWLNDIGLSQ
YSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRA
RCETQNIDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMATALGI
PSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRASSVTRAGKEENSSGLKYKAG
RLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSLEVTNV
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgatggaagacaataagcagctcgcgctccgcatcgatggggcggtccagtcggccagc
caggaggtgaccaacctgcgagccgaactcacggccaccaaccggagactggcggaactg
agcggcggcggcggccccggcccgggcccgggagccgcggccagcgcctcggcggcgggg
gactcggcggcgacgaacatggagaacccccagcttggagcgcaagtgctcctgcgggaa
gaagtgtcgcggctccaggaggaagttcaccttctccggcagatgaaggagatgttggcg
aaggacctggaggagtcgcagggcggcaagtcctctgaggtcctctcggccaccgagctc
agggtccagctggcccagaaggagcaggagctagccagagccaaagaagccttgcaggcc
atgaaagctgatcggaagcgcttaaagggcgagaagacagacctggtgagccagatgcag
cagctgtatgccacactggagagccgcgaggagcagctccgagacttcatccgcaactat
gagcagcaccgcaaggagagcgaggatgcggtcaaagcgctggccaaggagaaggacctg
ctggagcgtgagaagtgggagctgcggcgccaagccaaggaggccacagaccacgccacg
gcactgcgctcccagctggacctcaaggacaaccggatgaaggagctggaggccgagctg
gccatggccaaacagtccttagctacgctgaccaaggacgtccccaagcggcattccctc
gccatgccgggcgagacggtgctcaatggcaaccaggagtgggtggtgcaggcggacctc
ccgctgaccgcagccatccggcagagtcaacagactctctaccactcacacccccctcac
cctgcggaccggcaagcggtcagggtgagcccctgccactcccggcagccctctgtcatc
tccgacgcatctgccgccgaaggcgaccggtcgtccacaccgagcgacatcaactcccct
cgacaccggacacactccctctgcaacggcgacagtcccggcccagttcagaagaacctg
cacaaccctattgtacagtcactagaggatcttgaagaccaaaaacggaaaaagaagaaa
gagaagatgggattcggctccatctcccgcgtcttcgccagagggaagcagcggaagtcc
ctcgaccccggcctctttgatgactcggacagccagtgcagccccacgcggcagagcctc
agcctgtcggaaggcgaggagcagatggaccggctgcagcaggtggagctggtgaggacc
acccctatgtcccactggaaggcgggcaccgtccaggcctggctggaggtggtgatggcc
atgcctatgtacgtcaaggcctgcacggagaacgtgaagagcgggaaggtgctgctgagc
ctgagtgacgaggacctgcagctgggccttggggtgtgcagctccctgcaccggcgcaag
ctgcgcctggccatcgaggactaccgtgatgccgaggcaggccgcagcctgtccaaagct
gccgagctggaccatcactgggtggccaaggcctggctgaatgacattggcctgtcccag
tactcccaggcctttcagaaccacctggttgatgggcggatgctgaattccctgatgaag
cgagacctggagaagcacctgaacgtgtccaagaagttccaccaggtcagcatcctgctg
gggatcgagctgctgtaccaagtgaacttcagcagggaggccctccaggagcgccgggcc
cgctgcgagacgcagaacattgaccccgtggtgtggaccaaccagcgggtgctcaagtgg
gttcgagacatcgacctgaaggagtacgcagacaacctgaccaacagcggcgtccatggt
gctgtgctggtgctggagcccacattcaatgccgaggccatggccactgccctgggcatc
cccagtgggaagcacatcctccggagacacctggcagaggagatgagcgccgtcttccac
ccagccaactccacaggcatccgggaggctgagcgttttggaacgccccctggcagggcc
tccagcgtcacgcgggcaggaaaggaggagaacagcagcggtctcaagtacaaggctggc
cggctgcccctggggaagataggaaggggcttcagcagcaaagatcccgatttccatgat
gactatggctctcttcaaaacgaagattgcggagacgatgacccccagagcaggctggaa
cagtgccgtctggaaggctacaacagcctggaggtcaccaacgtgtaa

DBGET integrated database retrieval system