KEGG   Homo sapiens (human): 23256Help
Entry
23256             CDS       T01001                                 

Gene name
SCFD1, C14orf163, RA410, SLY1, SLY1P, STXBP1L2
Definition
(RefSeq) sec1 family domain containing 1
  KO
K19998  sec1 family domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23256 (SCFD1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    23256 (SCFD1)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    23256 (SCFD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 cwf21
Motif
Other DBs
NCBI-GeneID: 23256
NCBI-ProteinID: NP_057190
OMIM: 618207
HGNC: 20726
Ensembl: ENSG00000092108
Vega: OTTHUMG00000029420
Pharos: Q8WVM8(Tbio)
UniProt: Q8WVM8
Position
14q12
AA seq 642 aa AA seqDB search
MAAAAAATAAAAASIRERQTVALKRMLNFNVPHIKNSTGEPVWKVLIYDRFGQDIISPLL
SVKELRDMGITLHLLLHSDRDPIPDVPAVYFVMPTEENIDRMCQDLRNQLYESYYLNFIS
AISRSKLEDIANAALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPD
ITDTEMETVMDTIVDSLFCFFVTLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDARNSL
FTGDTLGAGQFSFQRPLLVLVDRNIDLATPLHHTWTYQALVHDVLDFHLNRVNLEESSGV
ENSPAGARPKRKNKKSYDLTPVDKFWQKHKGSPFPEVAESVQQELESYRAQEDEVKRLKS
IMGLEGEDEGAISMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDV
YFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKAL
TDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVL
KQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGN
YIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcagcgacagcagcagcagcagccagtattcgggaaaggcagaca
gtggctttgaagcgtatgttgaatttcaatgtgcctcatattaaaaacagcacaggagaa
ccagtatggaaggtactcatttatgacagatttggccaagatataatctctcctctgcta
tctgtgaaggagctaagagacatgggaatcactctgcatctgcttttacactctgatcga
gatcctattccagatgttcctgcagtatactttgtaatgccaactgaagaaaatattgac
agaatgtgccaggatcttcgaaatcaactatatgaatcatattatttaaattttatttct
gctatttcaagaagtaaactggaagatattgcaaatgcagcgttagcagctagtgcagta
acacaagtagccaaggtttttgaccaatatctcaattttattactttggaagatgatatg
tttgtattatgtaatcaaaataaggagcttgtttcatatcgtgccattaacaggccagat
atcacagacacggaaatggaaactgttatggacactatagttgacagcctcttctgcttt
tttgttactctgggtgctgttcctataatcagatgttcaagaggaacagcagcagaaatg
gtagcagtgaaactagacaagaaacttcgagaaaatctaagagatgcaagaaacagtctt
tttacaggtgatacacttggagctggccaattcagcttccagaggcccttattagtcctt
gttgacagaaacatagatttggcaactcctttacatcatacttggacatatcaagcattg
gtgcacgatgtactggatttccatttaaacagggttaatttggaagaatcttcaggagtg
gaaaactctccagctggtgctagaccaaagagaaaaaacaagaagtcttatgatttaact
ccggttgataaattttggcaaaaacataaaggaagtccattcccagaagttgcagaatca
gttcagcaagaactagaatcttacagagcacaggaagatgaggtcaaacgacttaaaagc
attatgggactagaaggggaagatgaaggagccataagtatgctttctgacaataccgct
aagctaacatcagctgttagttctttgccagaactccttgagaaaaaaagacttattgat
ctccatacaaatgttgccactgctgttttagaacatataaaggcaagaaaattggatgta
tattttgaatatgaagaaaaaataatgagcaaaactactctggataaatctcttctagat
ataatatcagaccctgatgcaggaactccagaagataaaatgaggttgtttcttatctat
tatataagcacacagcaagcaccttctgaggctgatttggagcaatataaaaaagcttta
actgatgcaggatgcaaccttaatcctttacaatatatcaaacagtggaaggcttttacc
aagatggcctcagctccggccagctatggcagcactaccactaaaccaatgggtctttta
tcacgagtcatgaatacaggatcacagtttgtgatggaaggagtgaagaacctggttttg
aaacagcaaaatctacctgttactcgtattttggacaatcttatggagatgaagtcaaac
cccgaaactgatgactatagatattttgatcccaaaatgctgcggggcaatgacagctca
gttcccagaaataaaaatccattccaagaggccattgtttttgtggtgggaggaggcaac
tacattgaatatcagaatcttgttgactacataaaggggaaacaaggcaaacacatttta
tatggctgcagtgagctttttaatgctacacagttcataaaacagttgtcacaacttgga
caaaagtaa

DBGET integrated database retrieval system