KEGG   Homo sapiens (human): 23265Help
Entry
23265             CDS       T01001                                 

Gene name
EXOC7, 2-5-3p, BLOM4, EX070, EXO70, EXOC1, Exo70p, YJL085W
Definition
(RefSeq) exocyst complex component 7
  KO
K07195  exocyst complex component 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    23265 (EXOC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23265 (EXOC7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23265 (EXOC7)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    23265 (EXOC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    23265 (EXOC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo70 Vps52 COG5 RolB_RolC Sec20
Motif
Other DBs
NCBI-GeneID: 23265
NCBI-ProteinID: NP_001138769
OMIM: 608163
HGNC: 23214
Ensembl: ENSG00000182473
Vega: OTTHUMG00000150720
Pharos: Q9UPT5(Tbio)
UniProt: Q9UPT5 Q63HP7
Position
17q25.1
AA seq 735 aa AA seqDB search
MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSI
IPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQ
KAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDL
EAQEDVTLEHLPESVLQDVIRISRWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFHK
SSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLE
GLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPLAGRDDMLDVE
TDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKA
IVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFA
DNIKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEF
SKRLLSTYICKVLGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVT
QKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGVKLRDKERQIIKERFKGFN
DGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGV
EQVGDMIDRLFDTSA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgattcccccacaggaggcatccgctcgacggcgggagattgaggacaagctgaagcag
gaggaggagactctgtccttcatccgagacagcctggagaagagcgaccagctcactaag
aacatggtgtctatcttatcatcctttgagagccgccttatgaagctggagaactccatc
atccctgtgcacaagcagacggagaatctgcagcggctgcaggagaatgttgagaagacg
ctgtcctgcctggaccatgtcatcagctactaccatgtggccagtgacactgagaagatc
atcagagagggccccacaggtaggctggaagagtacctgggaagcatggccaagattcag
aaggcagtggagtatttccaggacaacagcccagacagcccggaactcaacaaagtgaaa
ctgctctttgagcgcgggaaggaggccctggagtccgaatttcgcagcctgatgacgcgg
cacagtaaggtcgtctcgcccgtgctcatcttggatctgatcagtggtgacgatgatctg
gaggcccaggaggacgtgaccctggagcacctgcccgagagcgtgctccaggatgtcatt
cgcatctcccgctggctggtggaatatggccgcaaccaagatttcatgaacgtctactac
cagatacgctccagccagctggaccgctccatcaaaggactgaaggagcatttccataag
agcagttcttcctctggggttccctactcccctgctatccccaacaagaggaaagacaca
cctaccaagaagccagtcaagcggccagggacgatccgtaaggctcagaaccttctgaaa
cagtattcccagcatggtctagatgggaaaaaggggggctctaacctcattcctctggaa
gggcttcttccctgtaccccaaggggcggcctgcctggcccctggataaacgctgcttgt
gtttgtgcggccgacatctcgccaggtcacgagcatgatttccgagttaagcacctgtcc
gaggccttgaacgacaagcacgggccgctggccgggagagatgacatgctggacgtggag
accgatgcctacatccactgcgtcagtgccttcgtcaagctggcgcagagcgagtaccag
ctgctggccgacatcatccccgagcaccaccagaagaagaccttcgactccctgatacag
gatgccctggatgggctgatgcttgaaggggagaacatcgtgtctgctgcccggaaggcc
attgtgcgacacgacttctccacggtgctcaccgtcttccccatcctgcgacacctcaag
cagaccaagcctgagtttgaccaggtgctccagggcacggctgccagcacaaagaacaag
ctgcctggcctcatcacatccatggagaccatcggtgccaaagcgctggaggacttcgca
gacaacatcaagaatgacccggacaaggagtacaacatgccgaaggacggcaccgtacac
gagctcaccagcaatgccatcctcttcctgcagcagcttttggacttccaggagacggca
ggcgccatgctggcctcccaagagaccagctcttcggccaccagctacagctctgagttc
agcaagcggctgctaagcacctatatctgtaaagtgctgggcaacctgcagttgaacttg
ctgagcaagtccaaggtgtacgaggacccagctctgagcgccatcttcctgcacaacaac
tacaattacatcctcaagtccctggagaagtctgaactgatccagctggtggcagtgaca
cagaagactgctgagcgctcctaccgggagcacattgagcagcagatccagacctaccag
cgcagctggttaaaggtgactgattacatcgcagagaagaatctacctgtgttccagccg
ggagtcaagctccgggacaaggagcggcagattatcaaggagcgttttaagggcttcaat
gatggcctcgaagaactgtgcaaaatccagaaggcctgggctattccagacacagagcag
agggacaggattcgccaggcccagaagaccattgtcaaggagacctacggggcctttcta
cagaagtttggcagcgtgcccttcaccaagaacccggagaagtacatcaagtacggggtg
gagcaggtgggcgacatgatcgatcgccttttcgacacctctgcctga

DBGET integrated database retrieval system