KEGG   Homo sapiens (human): 23266
Entry
23266             CDS       T01001                                 

Gene name
ADGRL2, CIRL2, CL2, LEC1, LPHH1, LPHN2
Definition
(RefSeq) adhesion G protein-coupled receptor L2
  KO
K04593  adhesion G protein-coupled receptor L2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23266 (ADGRL2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    23266 (ADGRL2)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   23266 (ADGRL2)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Latrophilin
   23266 (ADGRL2)
SSDB
Motif
Pfam: Latrophilin OLF 7tm_2 GAIN Gal_Lectin GPS HRM DUF5074
Other DBs
NCBI-GeneID: 23266
NCBI-ProteinID: NP_001317574
OMIM: 607018
HGNC: 18582
Ensembl: ENSG00000117114
Vega: OTTHUMG00000009844
Pharos: O95490(Tbio)
UniProt: O95490
Position
1p31.1
AA seq 1416 aa
MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEA
TWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPN
QYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIIST
TSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWP
QTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAA
SLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQKREK
TCRAYLKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTR
VSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIY
RSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDP
DNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKD
GVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIG
IDKTKYAIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLF
PATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHS
NTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFI
FIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMW
NDTVRKQSESSFISGDINSTSTLNQGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYND
SVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVA
DASSLMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHL
QSPNRDSLYTSMPNLRDSPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCY
QISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
NT seq 4251 nt   +upstreamnt  +downstreamnt
atggtgtcttctggttgcagaatgcgaagtctgtggtttatcattgtaatcagcttctta
ccaaatacagaaggtttcagcagagcagctttaccatttgggctggtgaggcgagaatta
tcctgtgaaggttattctatagatctgcgatgcccgggcagtgatgtcatcatgattgag
agcgctaactatggtcggacggatgacaagatttgtgatgctgacccatttcagatggag
aatacagactgctacctccccgatgccttcaaaattatgactcaaaggtgcaacaatcga
acacagtgtatagtagttactgggtcagatgtgtttcctgatccatgtcctggaacatac
aaataccttgaagtccaatatgaatgtgtcccttacatttttgtgtgtcctgggaccttg
aaagcaattgtggactcaccatgtatatatgaagctgaacaaaaggcgggtgcttggtgc
aaggaccctcttcaggctgcagataaaatttatttcatgccctggactccctatcgtacc
gatactttaatagaatatgcttctttagaagatttccaaaatagtcgccaaacaacaaca
tataaacttccaaatcgagtagatggtactggatttgtggtgtatgatggtgctgtcttc
tttaacaaagaaagaacgaggaatattgtgaaatttgacttgaggactagaattaagagt
ggcgaggccataattaactatgccaactaccatgatacctcaccatacagatggggagga
aagactgatatcgacctagcagttgatgaaaatggtttatgggtcatttacgccactgaa
cagaacaatggaatgatagttattagccagctgaatccatacactcttcgatttgaagca
acgtgggagactgtatacgacaaacgtgccgcatcaaatgcttttatgatatgcggagtc
ctctatgtggttaggtcagtttatcaagacaatgaaagtgaaacaggcaagaactcaatt
gattacatttataatacccgattaaaccgaggagaatatgtagatgttcccttccccaac
cagtatcagtatattgctgcagtggattacaatccaagagataaccaactttacgtgtgg
aacaataacttcattttacgatattctctggagtttggtccacctgatcctgcccaagtg
cctaccacagctgtgacaataacttcttcagctgagctgttcaaaaccataatatcaacc
acaagcactacttcacagaaaggccccatgagcacaactgtagctggatcacaggaagga
agcaaagggacaaaaccacctccagcagtttctacaaccaaaattccacctataacaaat
atttttcccctgccagagagattctgtgaagcattagactccaaggggataaagtggcct
cagacacaaaggggaatgatggttgaacgaccatgccctaagggaacaagaggaactgcc
tcatatctctgcatgatttccactggaacatggaaccctaagggccccgatcttagcaac
tgtacctcacactgggtgaatcagctggctcagaagatcagaagcggagaaaatgctgct
agtcttgccaatgaactggctaaacataccaaagggccagtgtttgctggggatgtaagt
tcttcagtgagattgatggagcagttggtggacatccttgatgcacagctgcaggaactg
aaacctagtgaaaaagattcagctggacggagttataacaagctccaaaaacgagagaag
acatgcagggcttaccttaaggcaattgttgacacagtggacaaccttctgagacccgaa
gctttggaatcatggaaacatatgaattcttctgaacaagcacatactgcaacaatgtta
ctcgatacattggaagaaggagcttttgtcctagctgacaatcttttagaaccaacaagg
gtctcaatgcccacagaaaatattgtcctggaagttgccgtactcagtacagaaggacag
atccaagactttaaatttcctctgggcatcaaaggagcaggcagctcaatccaactgtcc
gcaaataccgtcaaacagaacagcaggaatgggcttgcaaagttggtgttcatcatttac
cggagcctgggacagttccttagtacagaaaatgcaaccattaaactgggtgctgatttt
attggtcgtaatagcaccattgcagtgaactctcacgtcatttcagtttcaatcaataaa
gagtccagccgagtatacctgactgatcctgtgctttttaccctgccacacattgatcct
gacaattatttcaatgcaaactgctccttctggaactactcagagagaactatgatggga
tattggtctacccagggctgcaagctggttgacactaataaaactcgaacaacgtgtgca
tgcagccacctaaccaattttgcaattctcatggcccacagggaaattgcatataaagat
ggcgttcatgaattacttcttacagtcatcacctgggtgggaattgtcatttcccttgtt
tgcctggctatctgcatcttcaccttctgctttttccgtggcctacagagtgaccgaaat
actattcacaagaacctttgtatcaaccttttcattgctgaatttattttcctaataggc
attgataagacaaaatatgcgattgcatgcccaatatttgcaggacttctacactttttc
tttttggcagcttttgcttggatgtgcctagaaggtgtgcagctctacctaatgttagtt
gaagtttttgaaagtgaatattcaaggaaaaaatattactatgttgctggttacttgttt
cctgccacagtggttggagtttcagctgctattgactataagagctatggaacagaaaaa
gcttgctggcttcatgttgataactactttatatggagcttcattggacctgttaccttc
attattctgctaaatattatcttcttggtgatcacattgtgcaaaatggtgaagcattca
aacactttgaaaccagattctagcaggttggaaaacattaagtcttgggtgcttggcgct
ttcgctcttctgtgtcttcttggcctcacctggtcctttgggttgctttttattaatgag
gagactattgtgatggcatatctcttcactatatttaatgctttccagggagtgttcatt
ttcatctttcactgtgctctccaaaagaaagtacgaaaagaatatggcaagtgcttcaga
cactcatactgctgtggaggcctcccaactgagagtccccacagttcagtgaaggcatca
accaccagaaccagtgctcgctattcctctggcacacagagtcgtataagaagaatgtgg
aatgatactgtgagaaaacaatcagaatcttcttttatctcaggtgacatcaatagcact
tcaacacttaatcaaggacattcactgaacaatgccagggatacaagtgccatggatact
ctaccgctaaatggtaattttaacaacagctactcgctgcacaagggtgactataatgac
agcgtgcaagttgtggactgtggactaagtctgaatgatactgcttttgagaaaatgatc
atttcagaattagtgcacaacaacttacggggcagcagcaagactcacaacctcgagctc
acgctaccagtcaaacctgtgattggaggtagcagcagtgaagatgatgctattgtggca
gatgcttcatctttaatgcacagcgacaacccagggctggagctccatcacaaagaactc
gaggcaccacttattcctcagcggactcactcccttctgtaccaaccccagaagaaagtg
aagtccgagggaactgacagctatgtctcccaactgacagcagaggctgaagatcaccta
cagtcccccaacagagactctctttatacaagcatgcccaatcttagagactctccctat
ccggagagcagccctgacatggaagaagacctctctccctccaggaggagtgagaatgag
gacatttactataaaagcatgccaaatcttggagctggccatcagcttcagatgtgctac
cagatcagcaggggcaatagtgatggttatataatccccattaacaaagaagggtgtatt
ccagaaggagatgttagagaaggacaaatgcagctggttacaagtctttaa

DBGET integrated database retrieval system