KEGG   Homo sapiens (human): 23271
Entry
23271             CDS       T01001                                 
Symbol
CAMSAP2, CAMSAP1L1
Name
(RefSeq) calmodulin regulated spectrin associated protein family member 2
  KO
K17493  calmodulin-regulated spectrin-associated protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23271 (CAMSAP2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23271 (CAMSAP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23271 (CAMSAP2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     23271 (CAMSAP2)
  Intermediate filaments
   Intermediate filament-binding proteins
    23271 (CAMSAP2)
SSDB
Motif
Pfam: CAMSAP_CKK CAMSAP_CH CAMSAP_CC1 CH
Other DBs
NCBI-GeneID: 23271
NCBI-ProteinID: NP_001284636
OMIM: 613775
HGNC: 29188
Ensembl: ENSG00000118200
Pharos: Q08AD1(Tbio)
UniProt: Q08AD1 B3KTI4
Position
1:200738893..200860704
AA seq 1489 aa
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELQEPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPDVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVKDMPS
IPVLNAAKRNVLDSSSDFPSSGEGATFTQSHHHLPSRYSRPQAHSSASGGIRRSSSMSYV
DGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIR
KNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPLNTNELNSNENIHYKLPNGALQNRIL
LDEFGNQIETPSIEEALQIIHDTEKSPHTPQPDQIANGFFLHSQEMSILNSNIKLNQSSP
DNVTDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQD
YDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSS
QKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQKK
KMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKTDGQ
RSKSLADIKESMENPQAKWLKSPTTPIDPEKQWNLASPSEETLNEGEILEYTKSIEKLNS
SLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSKQAGLSSAIAPFS
SDSPRPTHPSPQSSNRKSASFSVKSQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSP
SQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESKGTLEQRGHNPEEKEIKPFESTV
SEVLSLPVTETVCLTPNEDQLNQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVP
VEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQL
EAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVK
QKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSP
SRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNE
GQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEG
LYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
NT seq 4470 nt   +upstreamnt  +downstreamnt
atgggggatgctgcagaccccagggagatgagaaagacgttcattgttccagccatcaag
ccttttgaccactatgatttctccagggccaaaatcgcctgcaatctggcctggctggtg
gccaaagcctttgggacagaaaatgtgccagaggaacttcaagaaccattttacacagat
cagtatgaccaggaacacatcaaaccacctgttgttaatttgcttctatcggctgaacta
tactgtcgtgctgggagtctcattctcaagagtgatgctgcaaaaccccttttgggccat
gatgctgtaatccaggctttagcacagaaaggtctttatgtcactgaccaggaaaaattg
gtaactgaacgagatctccacaagaaacccatacagatgagtgcacatttggccatgatc
gataccctcatgatggcttatactgtagaaatggtcagtatagaaaaagtaattgcgtgt
gctcagcagtattcagctttttttcaagccacagatctgccctatgatattgaggacgct
gtcatgtactggataaataaggtaaatgaacatttgaaagacataatggaacaagaacaa
aaactgaaagaacatcacacagttgaagctccaggaggtcaaaagtctccttccaaatgg
ttttggaaactggttccagctcgttatcggaaagagcaaacattgcttaagcaactgcct
tgcattccattggtagaaaatttgttgaaggatgggacagatggctgtgcattagctgcc
cttattcatttttactgtcctgatgttgtcagattagaggatatttgtttgaaagaaact
atgtctttggctgatagcctgtataatctgcagctgattcaagaattttgccaagaatac
ttgaaccagtgttgccatttcactctggaagatatgctctatgctgcttcatccataaag
agtaattatttggtgttcatggcggaactgttctggtggtttgaagtggtgaagccgtct
tttgtacagcctcgtgttgttcgtccacaaggagctgaacctgtaaaagatatgccttca
attcctgtcttgaatgctgccaaaagaaatgtcttagatagtagttctgacttcccttca
agtggggaaggagctacatttacacagtctcatcatcatttgccttctaggtattcacgt
ccccaggctcattcttcagcctcaggaggaattagaaggtcttcatctatgtcttatgtt
gatggcttcatagggacatggcccaaagagaaaagatcatcagtgcatggcgtatcattt
gatatttcttttgataaagaagatagtgtacagagatccactccaaaccgaggaatcact
cgttctattagtaatgaaggacttactctgaacaacagtcatgtatctaaacacattagg
aaaaatttgtccttcaagccaataaatggagaagaggaagcagagagcattgaagaagaa
cttaatatagattctcacagtgacctcaaatcttgtgtgccccttaacacaaatgaacta
aattctaatgagaatattcattacaagcttccaaatggagctttacaaaatagaatactt
cttgacgagtttggcaatcagatcgagacaccaagcattgaagaagcattacaaataatt
catgatactgaaaaatctcctcatacacctcagccagaccaaattgctaatggcttcttt
cttcatagtcaagaaatgagtatcttaaattcaaatatcaagttaaatcaatctagtcct
gataatgtaactgatacgaaaggtgccttgagtcccataactgacaatactgaagtagac
actggaattcacgttccttcagaagatattcctgaaactatggacgaagattcttcgttg
agagattatactgtaagcttggactctgacatggatgatgcatctaaatttcttcaggat
tatgatattcgaactggcaacaccagggaagctttgagtccttgtccaagtactgtaagt
accaagtctcagccaggcagcagtgcttcttctagttctggagttaaaatgaccagcttt
gctgaacaaaaattcaggaaactgaatcataccgatggaaaaagtagtggaagcagttct
caaaaaactacaccagaaggctctgaacttaatattcctcatgtggttgcttgggcacaa
attccagaagaaacagggcttccacagggacgggacactacccagctgttggcctctgaa
atggtgcatcttaggatgaaactagaagaaaagaggcgtgctatagaagcccagaaaaag
aaaatggaagctgcttttaccaaacagagacagaaaatgggaaggacagcattccttact
gtagtgaaaaagaaaggggatgggatatctcctctacgagaggaagcggcgggtgcagaa
gatgagaaagtatatactgatcgagcaaaagaaaaggaatcacaaaaaactgatggacaa
aggagcaagtcactggcagatataaaagagagcatggagaatcctcaagccaaatggcta
aagtctccaactacacctattgatcctgagaagcagtggaacctggcaagcccctcagaa
gaaactttaaatgaaggagagattttagaatataccaaatccattgaaaagttaaattca
tccctgcattttctacaacaagaaatgcaacgcttgtcacttcagcaggagatgttaatg
cagatgagagagcaacaatcttgggtgatttcacctccacaaccctctccacagaaacag
attcgagattttaagccttctaagcaggcaggcctgtcatcagccattgcaccattctcc
tcagactcccctcgtcctactcacccatctccacagtcttctaacaggaaaagtgcatct
ttttctgttaaaagtcaaaggactcctaggccaaatgagttaaaaataacacctttgaat
cgaaccttgacacctcctcggtctgtggatagccttcctcggttaaggaggttttcacca
agtcaagttcctattcaaactaggtcatttgtatgttttggggatgatggagaacctcag
ttaaaggaatccaaacctaaagaggaagttaaaaaggaggaattggaatccaaagggact
ttggaacagcgtggacataatccagaagaaaaggaaatcaaaccttttgagtcaacagtc
tctgaagtcctatcactgcctgtcacagagactgtatgtctgacaccaaatgaggaccaa
ttgaatcaacccacagaaccccctcctaaacccgttttcccacccactgctccaaaaaat
gttaatctgattgaagtttccctctcagatttgaaaccccctgaaaaggctgatgtacct
gttgaaaaatatgatggagaaagtgataaagaacaatttgatgatgaccagaaagtatgc
tgtggattcttttttaaggatgatcaaaaagcagaaaatgatatggcaatgaaacgggca
gctttgttggagaaaagattaagaagggaaaaggaaactcagctccggaaacaacagttg
gaagcagaaatggagcataagaaggaggaaacaaggcgtaaaactgaggaagaacgtcag
aagaaagaagatgagagagcacgcagagaatttattaggcaagaatatatgaggcggaaa
caactgaaactaatggaagatatggatacagtaattaaaccccgtcctcaagtagtaaaa
caaaaaaaacagcgaccaaaatctattcacagagatcatattgaatcccccaaaacacca
ataaagggtcctccagtctctagcctttctttggcatcgctgaacacgggtgataacgag
agtgtacattcaggcaagaggacgccaagatcagagtctgtagaaggcttcttatctcca
agtcgttgtggcagtcgaaatggagaaaaagactgggagaatgcatcaacaacttcttca
gtggcttctggaacagaatatacaggaccaaagctctacaaagaacccagtgcaaaatcc
aataagcacataatacaaaatgctttagctcattgctgtttggctggaaaagtaaatgaa
ggtcagaagaaaaaaatactggaggaaatggagaaatcagatgccaacaacttcttaatc
ttgttccgggattcaggatgccagttcagatctttatacacttattgcccagaaactgaa
gaaatcaataaactgactgggataggccctaaatctatcactaaaaaaatgattgaagga
ctttacaaatataattctgacaggaaacagtttagccacatacccgctaaaactttatct
gccagtgttgatgcaattaccattcatagccatttatggcagaccaaaagaccagtaaca
cccaaaaaacttttacccactaaggcatag

DBGET integrated database retrieval system