KEGG   Homo sapiens (human): 23272
Entry
23272             CDS       T01001                                 
Symbol
TASOR, C3orf63, FAM208A, RAP140, TASOR1, se89-1
Name
(RefSeq) transcription activation suppressor
  KO
K21873  protein TASOR
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23272 (TASOR)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    23272 (TASOR)
SSDB
Motif
Pfam: DUF3715
Other DBs
NCBI-GeneID: 23272
NCBI-ProteinID: NP_001106207
OMIM: 616493
HGNC: 30314
Ensembl: ENSG00000163946
Pharos: Q9UK61(Tbio)
UniProt: Q9UK61
Structure
Position
3:complement(56620132..56683265)
AA seq 1512 aa
MATAVETEACQPTDASWESGGGGDDEMKQALPELESSQQNGGGGGLNIAEPSGGAGREEN
AGAEAAQSLSHEQPQDSSEAGAAALPRGPEEPERPVRRSFQIPRKSREKKALFQPLTPGS
REFEDVVNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSES
YAFLMVDRYQVQTICEKGLHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVI
FKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQY
YFYEYGFDELRRRPRHVCPYAVVSFTYKDDIQTPKFVPSSRSNSFNTDRNIDKYNYTLWK
GQLLNKGKLLCYISLRSATRAFLPIKLPEKLDVETVMSIDHLKQKIPPALFYKETYLGPN
EVLKNGMYCSLYEVVEKTRIGSNMESLLQKLDREKLVLVKPLGDRGYLFLLSPYQMVPPY
EYQTAKSRVLHALFLFQEPRSIVTSQKGSTNAAPQERHESMPDVLKIAQFLQFSLIQCRK
EFKNISAINFHSVVEKYVSEFFKRGFGSGKREFIMFPYDSRLDDKKFLYSAPRNKSHIDT
CLHAYIFRPEVYQLPICKLKELFEENRKLQQFSPLSDYEGQEEEMNGTKMKFGKRNNSRG
EAIISGKQRSSHSLDYDKDRVKELINLIQCRKKSVGGDSDTEDMRSKTVLKRKLEDLPEN
MRKLAKTSNLSENCHLYEESPQPIGSLGHDADLRRQQQDTCNSGIADIHRLFNWLSETLA
NARHSDASLTDTVNKALGLSTDDAYEELRQKHEYELNSTPDKKDYEQPTCAKVENAQFKG
TQSLLLEVDATSKYSVAISTSEVGTDHKLHLKEDPNLISVNNFEDCSLCPSVPIEHGFRR
QQSKSNNVEETEIHWKLIPITGGNARSPEDQLGKHGEKQTPGMKSPEEQLVCVPPQEAFP
NDPRVINRQRSSDYQFPSSPFTDTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERT
VLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDG
LHEKLNTIIIKASAKGGNLPPVSPNDSGAKIASNPLERHVIPVSSSDFNNKHLLEPLCSD
PLKDTNSDEQHSTSALTEVEMNQPQHATELMVTSDHIVPGDMAREPVEETTKSPSDVNIS
AQPALSNFISQLEPEVFNSLVKIMKDVQKNTVKFYIHEEEESVLCKEIKEYLIKLGNTEC
HPEQFLERRSKLDKLLIIIQNEDIAGFIHKIPGLVTLKKLPCVSFAGVDSLDDVKNHTYN
ELFVSGGFIVSDESILNPEVVTVENLKNFLTFLEELSTPEGKWQWKVHCKFQKKLKELGR
LNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTE
KNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLESQSDAVLTL
TPLELGVGISQH
NT seq 4539 nt   +upstreamnt  +downstreamnt
atggcgactgctgtggagacggaggcctgtcagccgacggatgcgagttgggaaagtggc
ggcggcggagacgacgagatgaagcaggcgcttccggagcttgagtcctcccaacaaaat
ggcggcggcggcggcctcaacatcgctgagcccagcggcggcgctgggcgtgaggagaac
gcgggggccgaggccgcccagagcctcagccacgagcagcctcaggactcctctgaggcg
ggcgcggccgccctgcccagaggccccgaagagcccgaaaggcctgttaggaggagtttt
cagatccccaggaagagcagagaaaagaaagcacttttccagccattaactccaggctct
cgagaatttgaagatgttgtaaatattctccattcttcttaccttgaaccaacctcagta
acaaattttaactacagacgtgcttgcttggtacacaatgagcttttggaaaaggagttt
acagaaaagcgaagagaactgaagtttgatggtcgtttagataaggaactttcagaatcc
tatgcatttctgatggttgatcgataccaggttcaaaccatatgtgaaaaaggattacat
gtgggtcagtccaaaataacaattcttggcagtccttccatgggtgtctatctttctagg
tatgctgatttattacaagcgaatcctttggacacgggggcaatgggtgatgttgttatt
tttaaaataatgaagggtaaaataaagagtatatatgaccccatgggtgtaaaaagtttg
gaatctatgttaaataagagtgctttggaccccacaccaaagcatgaatgtcacgtgtca
aagaatgccaatcgaattacatcacttttggcttacagagcctatgagcttactcagtat
tatttttatgagtatggctttgatgagctaaggcgaagaccaagacacgtttgtccatat
gcagttgtgtcttttacttacaaagatgatatacaaactccgaagtttgtaccttcatca
agatctaacagctttaatacagatagaaacatagataaatataactataccttgtggaaa
ggacagcttttaaataaaggaaaacttttgtgttatatttctctgaggtcagccactcgt
gcttttttgcctatcaaactacctgagaaattagatgttgaaacagttatgagtattgat
catctgaaacagaaaatccctccagcactgttttataaggaaacatacttaggtccaaat
gaagttttgaagaatggaatgtattgcagcctttatgaagttgtggaaaagacaagaatt
ggaagtaacatggagagtttactgcaaaaactagacagagaaaaacttgttcttgttaaa
cctttgggagaccgaggatacctttttcttctctccccttatcagatggttcctccatat
gaatatcagactgccaagtctcgagtcctacatgctttgtttctatttcaagaacctaga
agcatagttacttcacaaaaaggttcaaccaatgcagcaccacaggagaggcatgagagc
atgccagatgtattaaaaatagctcagtttttacaattttctttgattcagtgtcgaaag
gaattcaaaaatataagcgccataaattttcattctgttgttgaaaagtatgtaagtgaa
ttttttaagcgaggttttggttcaggtaaacgagagtttattatgtttccatatgattca
cgattagatgataaaaaattcttatactcagctcccagaaataaatcccatattgatact
tgtttgcatgcctatatttttcggcctgaagtgtatcagttacctatttgtaaattaaaa
gaactatttgaagaaaatagaaaacttcagcagtttagtccactttcagattatgaaggt
caagaagaagaaatgaatggtacaaaaatgaaatttggaaaacgaaataactcaagaggt
gaagccattatatctggaaagcaaagatcatctcattctttggattatgataaggataga
gtcaaagaattgattaatttaattcagtgtaggaaaaagagtgtgggtggggactcagac
acagaagatatgagaagcaaaactgtcttgaagaggaagcttgaggatctacctgaaaat
atgagaaagctcgccaaaaccagtaatttatctgaaaattgccatctgtatgaagagtct
ccacagcctattggctcacttggacatgatgctgacttgaggcggcagcagcaggatacc
tgtaactccggcattgctgacatccataggctgtttaattggttatcagaaacactagca
aatgcgcgccattctgatgcatctctgacagacacagtcaacaaagccttaggattgagc
actgatgatgcctatgaagagctgaggcaaaaacatgagtatgagttgaactctacccca
gataagaaagactatgagcagcctacttgtgcaaaagttgaaaatgcacagtttaagggt
actcagagcttattactagaagttgatgcaacatctaagtattctgttgctatttctacc
agcgaagtgggcactgaccataagctacatttgaaagaagatccaaatttaattagcgtg
aataattttgaagattgcagtttgtgtcccagtgttcccattgaacatggatttcgtaga
caacagtctaagtcaaataatgttgaagagactgaaatacattggaaactgattccaatt
acaggagggaatgcaagaagcccagaagaccagctggggaaacatggtgagaaacaaaca
ccaggtatgaaatcaccagaagaacaactggtgtgtgtgccaccacaggaggcctttcct
aacgacccccgggtaataaatagacagagaagttctgattaccagtttccatcctctcca
tttacagacacactaaagggcaccactgaggatgacgtgttgacaggtcaggtggaggag
cagtgtgtgccagcagcagaggcagagccgcctgcagtgagcgaaaccacagagaggaca
gtgttaggagagtacaatctcttttctaggaagatagaagagattttgaagcaaaagaat
gtttcatatgtcagtacagtttccacacctatcttttcaacacaagagaagatgaaacgg
ctttccgagttcatatattctaagacttccaaagctggtgtgcaggagtttgtagatggt
ttgcatgagaagctaaatactattattattaaagcatcagccaagggtgggaatttgcca
ccagtcagtcctaacgattctggtgctaagatagcatcgaatcctctggaaaggcatgtc
ataccagtttcctcaagtgacttcaacaataaacatctccttgagccactgtgtagtgat
cctttgaaagataccaactctgatgagcagcattccacttcggctttaactgaagtagaa
atgaaccagcctcaacatgccacagagttaatggtgacttctgatcatattgtacctggt
gatatggcccgggaaccagtagaagaaacaacaaaatcccccagtgatgtaaacatttct
gctcaaccagctctttcaaattttataagccagttagaacctgaagtatttaatagtttg
gttaaaatcatgaaagacgtccagaaaaatactgtgaaattttatattcatgaagaagaa
gagagtgtgctctgtaaagaaataaaggaatatcttatcaaattaggcaatacagaatgt
catcctgaacagtttttggaaagaagatcaaaattagataaactattgattattattcaa
aatgaagacattgcaggtttcattcacaagatacctggcttggtgactttaaagaagctc
ccctgtgttagttttgctggtgttgatagcctggatgatgttaaaaatcatacatacaat
gaattatttgtatctggaggttttatcgtatctgatgaatcaattctaaacccagaggtt
gtcacagttgagaaccttaaaaattttttgacattccttgaggaacttagtactccagaa
ggaaaatggcaatggaaagtccactgtaaatttcagaagaaactaaaggaactaggcaga
ttgaatgctaaagctctaagtctgttgacgcttctgaatgtctatcagaagaaacatctg
gttgaaattttgtcataccacaattgtgattcacaaactcgaaatgctccagaattggat
tgccttatcagacttcaggctcagaacatacagcaacgacacatagtctttttaacagag
aagaacatcaagatgctttccagttatacagataatggaatagtggttgcaactgctgaa
gacttcatgcaaaactttaaaaatcttgtgggctatcacaattcaatcacagaagaaaac
cttccacagcttggtgctaatgagaatcttgagtcgcagtcagatgctgttttgacatta
acccctttggagctgggagttgggatttcccaacattaa

DBGET integrated database retrieval system