KEGG   Homo sapiens (human): 23275Help
Entry
23275             CDS       T01001                                 

Gene name
POFUT2, C21orf80, FUT13
Definition
(RefSeq) protein O-fucosyltransferase 2
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    23275 (POFUT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    23275 (POFUT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     23275 (POFUT2)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   23275 (POFUT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT
Motif
Other DBs
NCBI-GeneID: 23275
NCBI-ProteinID: NP_598368
OMIM: 610249
HGNC: 14683
Ensembl: ENSG00000186866
Vega: OTTHUMG00000084874
Pharos: Q9Y2G5(Tbio)
UniProt: Q9Y2G5
Structure
PDB: 

Position
21q22.3
AA seq 429 aa AA seqDB search
MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRR
DVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVI
EYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFW
GYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSM
VFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIW
GHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELE
LYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE
QPTHWKITY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcgacactcagcttcgtcttcctgctgctgggggcagtgtcctggcctccggcttct
gcctccggccaggagttctggcccggacaatcggcggccgatattctgtcgggggcggct
tcccgcagacggtatcttctgtatgacgtcaaccccccggaaggcttcaacctgcgcagg
gatgtctatatccgaatcgcctctctcctgaagactctgctgaagacggaggagtgggtg
cttgtcctgcctccatggggccgcctctatcactggcagagtcctgacatccaccaggtc
cggattccctggtctgagttttttgatcttccaagtctcaataaaaacatccccgtcatc
gagtatgagcagttcatcgcagaatctggtgggccctttattgaccaggtttacgtcctg
caaagttacgcagaggggtggaaagaagggacctgggaagagaaggtggacgagcggccg
tgtattgatcagctcctgtactcccaggacaagcacgagtactacagaggatggttttgg
ggttatgaggagaccaggggtctaaacgtctcctgtctgtccgtccagggctcagcctcc
atcgtggcgcccctgctgctgagaaacacatcagcccggtccgtgatgttagacagagcc
gagaacctacttcacgaccactatggagggaaagaatactgggatacccgtcgcagcatg
gtgtttgccaggcacctgcgggaggtgggagacgagttcaggagcagacatctcaactcc
acggacgacgcagacaggatccccttccaggaggactggatgaagatgaaggtcaagctg
ggctccgcgctagggggcccctacctgggagtccacctgagaagaaaagatttcatctgg
ggtcacagacaggatgtacccagtctggaaggggccgtgaggaagatccgcagcctcatg
aagacccaccggctggacaaggtgtttgtggccacagatgccgtcagaaaggaatatgaa
gagctaaaaaagctgttacccgagatggtgaggtttgaacccacgtgggaggagctggag
ctctacaaggacggaggcgttgcgattattgaccagtggatctgcgcacacgccaggttt
tttattggcacctcagtctcaacattttcttttcggattcatgaggaaagagaaatcctg
gggttggaccccaagacgacgtacaacaggttctgcggagaccaagagaaggcgtgtgag
caacccacccactggaagatcacctactga

DBGET integrated database retrieval system