KEGG   Homo sapiens (human): 23276Help
Entry
23276             CDS       T01001                                 

Gene name
KLHL18
Definition
(RefSeq) kelch like family member 18
  KO
K10455  kelch-like protein 18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23276 (KLHL18)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     23276 (KLHL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 Kelch_2 BACK BTB Kelch_3 Kelch_4 Kelch_5 DUF3342 Glu_cyclase_2
Motif
Other DBs
NCBI-GeneID: 23276
NCBI-ProteinID: NP_079286
HGNC: 29120
Ensembl: ENSG00000114648
Vega: OTTHUMG00000156522
Pharos: O94889(Tdark)
UniProt: O94889 A0A024R2T4
Position
3p21.31
AA seq 574 aa AA seqDB search
MVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASI
PYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQL
QSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALP
LEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDR
VQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAG
DSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPET
DTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNR
SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMF
VCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSS
VEMYDPETDCWTFMAPMACHEGGVGVGCIPLLTI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggacggcgcggaggagctggaggatctggtgcacttctccgtgtctgagttg
cctagtcgcggctacggcgtcatggaggagatccggcggcagggcaagctgtgcgacgtg
accctcaagattggggaccacaaattcagtgcccaccggattgtcttagcagcctcgatc
ccgtatttccatgctatgtttacaaatgacatgatggagtgcaagcaggatgagattgta
atgcaaggaatggacccaagtgccctggaggctctgatcaactttgcctacaacggcaac
cttgccattgaccagcaaaatgtccagtcattgctgatgggggcgagcttcctgcagctg
cagagcatcaaagacgcctgctgcacattccttcgagaacggcttcacccaaaaaactgc
ctgggtgtgcgccagtttgctgagacaatgatgtgtgctgtgctgtacgacgctgccaac
agcttcatccaccagcactttgtggaggtgtccatgtcagaagagttcctggccctgccc
ttggaagacgtgcttgagctggtgtctcgggatgagctgaatgtcaaatctgaggagcag
gtctttgaagctgcattggcctgggtcagatacgaccgggagcagaggggtccctacctg
cctgagctgctgtccaatatccgcctgcccctctgtcggccccagttcctttcagacaga
gtacagcaggatgacctggtgcgttgctgccacaaatgcagggacctggtagacgaagca
aaggactaccacctcatgccagagcgccggccccacctgccagctttcagaacccggcca
cgctgctgcacatccatcgctggacttatctacgctgtagggggcctcaactcagcaggt
gattccctgaatgtggtggaagtgttcgaccccattgccaattgctgggagagatgccgt
cccatgacaacagcccgcagccgcgttggcgtggctgtggtgaacgggcttctctatgcc
atcggaggatatgacggccagctacggctgagcactgtggaggcctacaacccggagaca
gacacatggaccagagtggggagcatgaatagcaagagaagtgccatggggacagtcgtg
ctggatgggcagatctacgtctgtgggggctacgatggcaactcttccctcagctccgtg
gagacctactcacctgagacggacaaatggacagtggtgacctcgatgagctcgaatcgc
agtgctgctggggttacagtctttgagggcaggatatatgtgtcaggcggccatgatggt
ttgcagatcttcagcagtgtggaacactacaaccaccacacagccacctggcaccctgca
gctggcatgctcaacaagcgctgccggcacggagccgcctccctggggagcaagatgttt
gtctgcgggggctacgatggctctggcttcctcagcattgccgagatgtacagctctgtg
gcagaccagtggtgcctgattgtccccatgcacacgcgcaggagccgggtctccctggtg
gccagctgtgggcgcctctacgctgttgggggctacgacggacagtcaaacctaagctca
gtggagatgtatgacccagagacagactgctggacattcatggcccccatggcgtgccat
gagggaggggtcggtgtgggctgcatccctctcctcaccatctaa

DBGET integrated database retrieval system