KEGG   Homo sapiens (human): 23288Help
Entry
23288             CDS       T01001                                 

Gene name
IQCE, 1700028P05Rik, PAPA7
Definition
(RefSeq) IQ motif containing E
Organism
hsa  Homo sapiens (human)
Disease
H01852  Postaxial polydactyly
SSDB OrthologParalogGFIT
Motif
Pfam: IQ CaMBD Med10 DUF2764
Motif
Other DBs
NCBI-GeneID: 23288
NCBI-ProteinID: NP_689771
OMIM: 617631
HGNC: 29171
Ensembl: ENSG00000106012
Vega: OTTHUMG00000152047
Pharos: Q6IPM2(Tdark)
UniProt: Q6IPM2
Position
7p22.3
AA seq 695 aa AA seqDB search
MFLGTGEPALDTGDDSLSAVTFDSDVETKAKRKAFHKPPPTSPKSPYLSKPRKVASWRSL
RTAGSMPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWTGVPGGTPDCLTDTFRV
KRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSDVDLMRTKLRRLEEENSR
KDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKLEQQCKEKDGTISKLQTDM
KTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKKTGAKRQKKMGSALLSLSRS
VQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLLRRIVELEKKLSVMESSKSHA
AEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRDLKEERTALQEQLLQRDLEVKQ
LLQAKADLEKELECAREGEEERREREEVLREEIQTLTSKLQELQEMKKEEKEDCPEVPHK
AQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDGRRDAAARVLQAQWKVYKHKKKKA
VLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPIAQATGSPV
QEEAIVIIQSALRAHLARARHSATGKRTTTAASTRRRSASATHGDASSPPFLAALPDPSP
SGPQALAPLPGDDVNSDDSDDIVIAPSLPTKNFPV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggcaccggggagccggccttggacacgggagatgacagtctgtctgcagtc
acctttgactctgatgtggagacgaaagcaaaaaggaaagctttccacaaacctccaccc
acatcgccaaagtcaccttatctctctaagccgagaaaagtggcctcctggaggtccctc
aggacggcagggagcatgcctctgggcggccgagcgtccctgaccccgcagaagctgtgg
ctgggaaccgcaaagccaggaagtctgacccaggccctgaactcacccctcacctgggag
catgcgtggactggcgtccccggcggcactcctgactgtctgacagacaccttcagagtg
aagaggccacatctcaggcgctctgccagcaacggtcatgtccctgggactcctgtctac
agagaaaaagaagatatgtatgacgagattattgagttaaagaagtcattgcacgtgcag
aagagcgacgtggacctgatgagaacgaagctccggcgcctggaggaggaaaacagcagg
aaggaccggcagatagagcagctcctggatcccagccgcggcacggattttgttcggact
ctggcagagaaaaggcccgatgccagttgggtcattaacgggctgaagcagaggatcctg
aagctggaacagcagtgcaaggagaaggacggcaccatcagcaaactccagaccgatatg
aagactaccaacctggaagagatgcggatcgccatggagacatactacgaggaggtgcat
cgtctccagaccctcttggcaagttctgaaaccaccggaaagaagcccctgggggagaag
aagacgggcgccaaaaggcagaagaagatgggcagtgccctcctgagcttgtcccggagt
gtccaggagctcacggaagagaaccagagcctgaaggaggacctggaccgcgtgctgagc
acctccccaaccatctccaagacacagggttatgtggagtggagcaagccccggctgctg
aggcgcattgtggagctggagaagaaactaagtgtgatggagagctcaaaatcacacgcc
gcagagccagtcagatcacacccgccagcctgccttgcatccagctctgcgctgcacaga
cagccacgaggggaccgcaacaaggaccacgagcgtctccgaggggctgtgagagacctg
aaggaagagcggaccgcgctgcaggagcagctgctgcagagagatttggaggtgaagcag
ctcctgcaggcgaaggccgacctggagaaggagctggagtgcgcgagggagggcgaggag
gagaggagagagcgagaggaggttttgagagaggagattcagacacttaccagcaagctc
caagaattgcaagaaatgaagaaagaagagaaagaggattgcccggaagttcctcataag
gcccaagagctcccagctcccactcccagcagcaggcactgcgagcaagactggccgccg
gattccagcgaggaggggctcccgcggccccgctccccctgctctgatgggagaagagac
gccgcggccagagtcctgcaggcccagtggaaggtgtacaagcacaagaaaaaaaaggct
gttctggatgaggcggctgtggtgcttcaggcagctttcaggggacatctcacgcggaca
aagctcttagcaagcaaagcacatggctcagagccacccagcgtgccaggcctcccagac
cagagctctcctgtgccccgcgttccgagccccatcgcccaggccacgggcagccctgtg
caggaggaggccatcgtcatcatccagtccgctctgcgggcacacctggcccgggccagg
cacagtgctaccggtaaaagaaccaccaccgcagcttctaccaggaggagatcggcttca
gccacacacggggacgcctcctccccacccttcctcgcagctcttcctgacccctctccc
tcagggccacaggccttggcacctctacctggggatgacgtcaactccgatgattccgac
gatattgtcattgcaccgtctctgcccacgaagaactttccagtttag

DBGET integrated database retrieval system