KEGG   Homo sapiens (human): 23294Help
Entry
23294             CDS       T01001                                 

Gene name
ANKS1A, ANKS1
Definition
(RefSeq) ankyrin repeat and sterile alpha motif domain containing 1A
  KO
K21413  ankyrin repeat and SAM domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23294 (ANKS1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    23294 (ANKS1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3 SAM_1 SAM_2 PID PTB PID_2
Motif
Other DBs
NCBI-GeneID: 23294
NCBI-ProteinID: NP_056060
OMIM: 608994
HGNC: 20961
Ensembl: ENSG00000064999
Vega: OTTHUMG00000014559
Pharos: Q92625(Tbio)
UniProt: Q92625 Q05CP0
Structure
PDB: 

Position
6p21.31
AA seq 1134 aa AA seqDB search
MGKEQELLEAARTGHLPAVEKLLSGKRLSSGFGGGGGGGSGGGGGGSGGGGGGLGSSSHP
LSSLLSMWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADSKGCYPLHLA
AWKGDAQIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKVLLEELTDPTMRNN
KFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGMD
SNYQTEMGSALHEAALFGKTDVVQILLAAGTDVNIKDNHGLTALDTVRELPSQKSQQIAA
LIEDHMTGKRSTKEVDKTPPPQPPLISSMDSISQKSQGDVEKAVTELIIDFDANAEEEGP
YEALYNAISCHSLDSMASGRSSDQDSTNKEAEAAGVKPAGVRPRERPPPPAKPPPDEEEE
DHIDKKYFPLTASEVLSMRPRIHGSAAREEDEHPYELLLTAETKKVVLVDGKTKDHRRSS
SSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLCTAGQSHPDGSPQQGACHKA
SMQLEETGVHAPGASQPSALDQSKRVGYLTGLPTTNSRSHPETLTHTASPHPGGAEEGDR
SGARSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDATMGSRSESLSNCSIGKKRLEK
SPSFASEWDEIEKIMSSIGEGIDFSQERQKISGLRTLEQSVGEWLESIGLQQYESKLLLN
GFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDGNSPPSVPSWLD
SLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVQLLGHRKRIIASLADRPYEEPPQK
PPRFSQLRCQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGRRRHDSLHDPAAPSRAERF
RIQEEHREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTES
TQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLC
TFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAE
MIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLSTN
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggagctgctggaggcggcccgcaccgggcacctcccggcggtggag
aagctgctgtccgggaagcggctctcctcaggctttgggggcggcggcggcggtggctct
gggggcggcggcggcggcagcggcggcggcggcggcggcctcggctcttccagccacccc
ctctccagtctgctcagcatgtggagagggccaaatgtgaactgtgttgacagcactggc
tacacacccctgcaccatgctgctttgaatggccataaggatgtggtcgaggttcttctg
aggaacgatgcgctgaccaacgtggctgactcaaaaggctgctaccctctgcatttggca
gcctggaaaggagatgcccagatagtgcggttgctcatccatcaagggccttcacacacc
agagtcaatgaacagaacaatgacaacgagacagccctgcattgtgcagcgcagtatggc
cacacagaggtggtgaaggtgctcttagaggagctgacggaccccaccatgcgcaacaac
aaattcgagacccctttggacctggcagcactgtacgggcgactggaggtggtgaaaatg
ctccttaatgcacaccccaacctcctgagctgcaacactaagaagcacacccctctgcac
ttggcagcaaggaatggccacaaagccgtggtccaggtcctcctcgatgctggcatggac
agcaactaccagacggagatgggcagtgctttgcatgaggctgctttgtttggcaagacc
gatgtggtgcaaatcctgctggctgcaggaactgacgtcaacataaaagataaccatgga
ctgactgccctagacactgttcgggaactgccttctcaaaagagccagcaaatagcagca
ttaattgaagatcacatgactggaaaaagaagtacaaaagaagtagataaaaccccccca
ccccagccacctctcatctccagtatggactccatatcacagaagtctcagggtgacgtg
gagaaagcagtgactgaactgattatagattttgatgcaaatgctgaagaagagggtccc
tacgaagctctgtataatgccatctcctgccattcgttggacagcatggccagcgggcga
tcatctgaccaagactccacgaacaaggaggctgaggcagcaggagtgaaacctgctgga
gtgaggcctagggaacgtccaccacctccagcaaagccaccgcccgatgaagaggaagaa
gaccacatagataagaagtattttcccttgacagcttctgaggttctgtccatgagacct
aggattcatgggagtgcagcccgggaagaagacgaacacccttatgaactgttgttaaca
gcagagacaaagaaagtggtgttggtggatggaaaaacaaaagaccacaggcggagcagc
agcagccggagccaggactctgcggaggggcaggacgggcaggtcccagagcagttctca
ggcctcctccacggctcctccccggtgtgcgaggtggggcaggaccctttccagctgctc
tgtaccgctggccagagccatccagacgggtccccccagcagggcgcctgccacaaggcc
agcatgcagctggaggagacgggtgtgcatgctcctggagcctcccagcccagtgccctg
gaccagagcaagagagtgggctacctcacaggcctgcccaccaccaacagccgctcgcac
cctgaaactttgactcacacagcatctccgcaccctggtggtgctgaggaaggagaccgg
agtggggccaggagccgagcgcctcccactagcaaacccaaagctgaactcaaactcagc
cgcagcttgtccaagtctgactctgatctcctgacctgctcacccacagaggacgctacc
atggggagtcggagtgagtccttatccaactgcagcattgggaagaaaaggctagagaag
tcaccctccttcgcctcggagtgggatgagattgagaaaatcatgagttctattggagaa
gggattgacttttctcaggaacggcagaagatctcaggtttacggacgctggagcagagt
gtcggggagtggctggagtcgattgggctgcagcagtatgagagcaagttgcttctgaat
ggctttgacgatgtccacttcctggggtctaatgtgatggaagagcaggacctgcgggac
atcggcatcagcgacccacagcaccggcggaagctgctccaggcggcacgctccctaccc
aaggtgaaggctctgggttatgacgggaacagcccccctagcgtgccctcctggctggac
tccctggggctgcaggactacgtccattccttcttgtcaagtggttacagctccattgac
accgtgaagaacctctgggagctagagctcgtcaatgtcctgaaggtccagctgctcggc
catcgcaagcgcatcatcgcctccctcgcagacagaccgtacgaggagccgccccagaag
ccccccagattctcccagctgaggtgccaagatttgctctcccagacgtcatccccactg
agtcagaatgattcctgcactgggcggtcggcagatctgctgctgcctccaggggacaca
ggcaggaggcgccatgacagtctccatgaccctgcggcaccctcccgagcggagcgcttc
aggatccaggaggagcaccgtgaggccaagctgaccctgcggcccccgagcctggcagcc
ccctacgccccagtgcagagttggcaacaccagccagagaaactcatcttcgagtcctgt
ggttatgaagccaattatctgggctccatgctgatcaaagatctgcgagggacagaatcc
acgcaagacgcctgtgccaagatgcggaaatctacggagcacatgaagaagatccccacc
atcatcctgtccatcacatacaaaggtgtcaagttcatcgatgcctccaacaagaacgtc
attgcagagcacgagatccggaacatttcctgtgcggcccaggacccggaggacctctgt
acctttgcctacatcaccaaggacctgcagaccagccaccactattgccatgtgttcagc
accgtggatgtgaacctgacctacgagatcatcctgacgctggggcaggccttcgaagtg
gcctatcagttggccctgcaggcccagaagtccagggcgacgggcgcctctgcagctgag
atgattgaaacaaaatcttccaaaccggtgcctaagcctcgggtcggcgtgaggaaatcc
gcactggaaccacctgatatggaccaagatgcccaatcccatgccagtgtctcctgggtt
gtggaccccaaaccagactctaagcggagcctcagcaccaactga

DBGET integrated database retrieval system