KEGG   Homo sapiens (human): 23303Help
Entry
23303             CDS       T01001                                 

Gene name
KIF13B, GAKIN
Definition
(RefSeq) kinesin family member 13B
  KO
K17914  kinesin family member 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23303 (KIF13B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     23303 (KIF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin DUF3694 Microtub_bd Kinesin_assoc CAP_GLY KIF1B FHA Yop-YscD_cpl KMP11
Motif
Other DBs
NCBI-GeneID: 23303
NCBI-ProteinID: NP_056069
OMIM: 607350
HGNC: 14405
Ensembl: ENSG00000197892
Vega: OTTHUMG00000164032
Pharos: Q9NQT8(Tbio)
UniProt: Q9NQT8
Structure
PDB: 

Position
8p12
AA seq 1826 aa AA seqDB search
MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARGQPKVFAYDH
CFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQP
GLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLKVREHSVLG
PYVDGLSKLAVTSYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSG
TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQSAGKNKN
KFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIVNHAVVN
EDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEE
IAQERQKQLESLGISLQSSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQD
IQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFF
RLNLPKKKKKAEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEVNFNYEYAQMEVTMKA
LGSNDPMQSILNSLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPEKQNCRSMDRFSFH
SPSAQQRLRQWAEEREATLNNSLMRLREQIVKANLLVREANYIAEELDKRTEYKVTLQIP
ASSLDANRKRGSLLSEPAIQVRRKGKGKQIWSLEKLDNRLLDMRDLYQEWKECEEDNPVI
RSYFKRADPFYDEQENHSLIGVANVFLESLFYDVKLQYAVPIINQKGEVAGRLHVEVMRL
SGDVGERIAGGDEVAEVSFEKETQENKLVCMVKILQATGLPQHLSHFVFCKYSFWDQQEP
VIVAPEVDTSSSSVSKEPHCMVVFDHCNEFSVNITEDFIEHLSEGALAIEVYGHKINDPR
KNPALWDLGIIQAKTRSLRDRWSEVTRKLEFWVQILEQNENGEYCPVEVISAKDVPTGGI
FQLRQGQSRRVQVEVKSVQESGTLPLMEECILSVGIGCVKVRPLRAPRTHETFHEEEEDM
DSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKRDKTEDDADREAQLLEMRLTLTEE
RNAVMVPSAGSGIPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAGGWDATL
TGEEEEEFFELQIVKQHDGEVKAEASWDSAVHGCPQLSRGTPVDERLFLIVRVTVQLSHP
ADMQLVLRKRICVNVHGRQGFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQGVEEREA
LARMAANVENPASADSEAYIEKYLRSVLAVENLLTLDRLRQEVAVKEQLTGKGKLSRRSI
SSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPD
PGLSNLAASYLNPVKSFVPQMPKLLKSLFPVRDEKRGKRPSPLAHQPVPRIMVQSASPDI
RVTRMEEAQPEMGPDVLVQTMGAPALKICDKPAKVPSPPPVIAVTAVTPAPEAQDGPPSP
LSEASSGYFSHSVSTATLSDALGPGLDAAAPPGSMPTAPEAEPEAPISHPPPPTAVPAEE
PPGPQQLVSPGRERPDLEAPAPGSPFRVRRVRASELRSFSRMLAGDPGCSPGAEGNAPAP
GAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSG
KNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATN
LASLTAALAKADRSHKNPENRKSWAS
NT seq 5481 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccaaagtgaaagtggcggtgcggatacgacccatgaaccggcgagagact
gacttgcataccaaatgtgtggtggatgtggatgcaaacaaggttattcttaatcctgta
aatacgaatctttccaaaggagatgcccggggccagccgaaggtgtttgcttatgatcat
tgtttctggtctatggatgaatctgtcaaagaaaagtatgcaggtcaagatattgttttc
aagtgccttggagagaatatcctgcagaatgcttttgatggctacaatgcatgtatcttt
gcctatggacagactggctctggaaaatcttataccatgatgggcacagctgaccaacct
ggattaatcccaagactttgcagtggactctttgaacgaactcagaaagaggaaaatgaa
gaacagagttttaaagtagaagtgtcctacatggaaatttataatgaaaaagttcgagac
cttcttgatcccaaaggaagccgtcagacgttgaaagtcagagagcatagtgtgttggga
ccttatgtcgacggactttctaaactggctgtcacaagctacaaggatattgagtcgttg
atgtctgagggtaacaaatctcgcacagttgctgcaaccaacatgaacgaggagagtagc
cgatcccatgcagttttcaaaatcaccctcacacatactctctacgatgtgaagtctggg
acatctggagagaaagtgggcaaactcagcctggtggatttagctggcagtgaacgagca
acgaagacaggcgctgcaggggacaggctgaaggaagggagcaacattaacaagtccctc
acaaccctcggtctggttatctcagctcttgcagatcagagtgctggcaaaaacaagaat
aaatttgttccatatcgtgactcagttctcacttggctgctcaaagacagcctcgggggt
aacagcaagaccgccatggtggctactgtgagtcctgcagctgataactatgatgaaacc
ctctcaactctgcggtatgcagatcgagccaagcacattgtaaaccacgctgtggtgaat
gaggaccctaatgcccgaattatccgggatctccgggaagaagttgagaaactccgggag
cagctgaccaaagcagaggcaatgaaatctccagagctaaaggaccggctggaagaatct
gagaagctaatccaggaaatgactgtgacctgggaggagaaattaaggaaaacggaggag
attgcacaggaacgacagaaacagcttgagagtcttggaatatctcttcagtcttcggga
atcaaagttggggatgataaatgcttccttgtgaatctgaatgctgacccagctctgaat
gagcttctggtgtactatttaaaggaacatacattgatagggtcagcaaattcccaagat
atccaactgtgcggcatgggaattcttcctgaacactgtattatagacatcacgtcagaa
ggccaggttatgctgactcctcagaagaacaccagaacatttgtaaatgggtcatctgtc
tccagtccaatacagctacaccatggggacaggatattatggggaaacaatcatttcttc
agactcaatttgcctaaaaagaaaaagaaagcagaacgagaggatgaggaccaggatccc
tccatgaagaacgagaatagttctgagcagctggatgtagacggagactcctccagcgag
gtgtccagtgaagttaactttaattacgaatacgcacagatggaggtcaccatgaaggcc
ctgggcagcaatgatccgatgcagtccatattaaacagcttagaacaacagcatgaagaa
gaaaaacgatctgcactggagcgccagaggcttatgtatgagcacgaattggagcagctc
cggagaaggctgtctcctgagaagcagaactgccggagcatggacaggttttctttccac
tcgcccagcgctcagcaacgcttaagacagtgggctgaggagagagaagcaacgttgaat
aacagcctgatgaggctgagggaacaaattgttaaggccaatctattggtgagagaagct
aattacattgctgaggagctggataaaagaacagaatacaaagttaccctacagattcca
gcctccagcctggatgccaacaggaagcgaggctctcttcttagtgagcctgcaatccag
gtgagaagaaaaggaaaaggaaagcagatttggtctttggaaaaactggacaacaggctg
ttggatatgagagacctttatcaggagtggaaagagtgtgaagaagataacccagtaata
cgatcatacttcaaacgtgctgatccattctatgatgagcaggaaaatcacagtctcatt
ggggtggccaatgtcttcctcgagtcacttttctatgatgtgaagttacaatacgctgtt
cccatcatcaaccagaaaggagaggtggcaggtcggctgcacgtggaggtgatgcgactc
agtggtgatgttggggagaggatcgcaggaggcgatgaggtggcagaggtctcctttgag
aaggagacccaggagaacaaactggtgtgcatggttaaaatcctgcaagctactgggttg
ccacagcatctgtcccactttgtgttctgcaaatacagcttctgggatcaacaggagccg
gtgattgtcgctcctgaagtggacacctcctcctcttccgtcagcaaggagccgcactgc
atggttgtctttgatcattgcaatgagttttctgttaacatcaccgaagactttatcgag
catctttccgaaggagcattggcaattgaagtatatggacataaaataaacgatccccgg
aaaaaccccgccctgtgggatttgggaatcatccaagcaaagacacgtagtcttcgggac
agatggagtgaagtgaccaggaaattggaattctgggttcaaatcttggaacagaatgag
aatggtgaatactgccctgtagaagtgatttctgcaaaggatgtcccaacaggaggaatc
ttccagctccggcaggggcagtcccggagagttcaagtcgaagtgaagtcagtgcaggaa
tctgggactttaccactgatggaagaatgtatactgtctgttggcattggatgtgtcaaa
gttagaccgctcagagcccccagaacacatgagaccttccatgaggaagaggaagacatg
gacagctaccaggatcgagatttagagagacttcgtagaaaatggctaaatgcattaaca
aaacgtcaggagtacttggatcaacaattgcaaaagcttgtcagtaaacgtgataaaaca
gaggatgatgctgaccgtgaagcgcagcttctggagatgcggttgaccctaactgaggag
aggaacgcggtgatggtcccctctgctggcagtggtattccaggggccccagcagaatgg
accccagtacctgggatggagacacacattcctgttatattcctggacttaaatgctgat
gatttcagctctcaggataatcttgatgacccagaagctggtggatgggatgcgaccttg
actggggaagaagaagaggagttctttgaattgcagattgtgaagcagcatgatggggag
gtgaaagcagaagcctcctgggactccgcggtgcatggctgccctcagctcagcaggggc
acgcccgtggacgagcggttgttcctgatcgtgcgcgtgacggtccagctcagccaccct
gctgacatgcaactggtgttacgcaagagaatctgtgtcaatgttcacggccgccagggt
tttgcacagagtctcctaaaaaagatgtctcatcgaagttctattcctggctgtggagtg
acttttgaaattgtctccaatattccagaggatgcccagggagtggaagaacgggaagca
ttagcaagaatggcagccaatgttgaaaacccagcttctgctgactcggaggcttatatt
gaaaagtacctcaggagcgtgctggctgtagaaaacctcctgactttagatcgtctgcgc
caggaagttgcagtgaaggaacagttaacaggaaaaggaaagttgagcaggaggagtatc
agttctccaaatgtgaacagattgtctggaagccgacaagatctcattccatcatacagt
ctaggcagcaacaagggccggtgggaaagtcagcaggatgtatcccaaaccacagtttcc
agaggaatagctcctgcccccgccctctctgtttctccccaaaataaccattctccagat
ccaggactcagtaaccttgcagcatcctacttgaatcctgtcaaatccttcgtgccgcaa
atgccaaagctcctcaagtctctctttcccgtccgcgatgagaagaggggcaagcggccg
tctcccctcgcacaccagcccgtgccccgcatcatggtgcagtcagccagcccggacatc
agggtgaccaggatggaggaggctcagccggagatgggccctgacgtgctggtgcagacg
atgggggccccggccttgaagatctgcgacaaacctgccaaagtgccttccccaccgcct
gtcatagctgtcacagcggtcaccccggctccggaggcacaggacgggccccccagcccc
ctgagtgaagcctctagcgggtacttctcccacagcgtctccaccgcgaccctgtcggac
gccctgggccccggcctggacgctgcggccccgccggggtccatgcccaccgcccctgag
gccgagcccgaggcgcccatcagccaccccccaccgcccacggccgtccccgccgaggag
ccccctggcccccagcagctcgtgagccccggtcgggagcgccccgacctcgaggccccg
gcgcccggctccccgttccgcgtccggagggtgcgggcctcggagttgcgctccttctcg
cgcatgctggctggggaccccggctgctccccgggggccgaggggaatgcgccggccccg
ggcgccgggggacaggccctggcctctgattccgaggaagctgacgaggtcccggagtgg
ctccgagagggcgagttcgtcaccgtgggcgcccacaaaacgggcgtggtgagatacgtg
gggcctgccgacttccaagagggcacgtgggtcggcgtggagctcgacctgccctcaggt
aagaatgacggttccatcggcgggaagcagtacttcaggtgtaaccctggctacgggctg
ctggtcaggcccagccgggtccgcagggccacgggccctgtgcggcggcgcagcacagga
ctccggctgggtgcccccgaggcccgccggagcgccaccctctcgggctccgccaccaac
ctggcctcgctgacagctgccctggccaaggccgacaggagccacaagaaccctgagaac
cggaaatcctgggccagctga

DBGET integrated database retrieval system