KEGG   Homo sapiens (human): 23305Help
Entry
23305             CDS       T01001                                 

Gene name
ACSL6, ACS2, FACL6, LACS_6, LACS2, LACS5
Definition
(RefSeq) acyl-CoA synthetase long chain family member 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    23305 (ACSL6)
   00071 Fatty acid degradation
    23305 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    23305 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    23305 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    23305 (ACSL6)
   03320 PPAR signaling pathway
    23305 (ACSL6)
  09159 Environmental adaptation
   04714 Thermogenesis
    23305 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    23305 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23305 (ACSL6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23305 (ACSL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23305 (ACSL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   23305 (ACSL6)
  Exosomal proteins of breast cancer cells
   23305 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 23305
NCBI-ProteinID: NP_001192177
OMIM: 604443
HGNC: 16496
Ensembl: ENSG00000164398
Vega: OTTHUMG00000150692
Pharos: Q9UKU0(Tbio)
UniProt: Q9UKU0 B2RB13
Position
5q31.1
AA seq 697 aa AA seqDB search
MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQ
SEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQW
LSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDT
LGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQK
CGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGF
LKVTESQWAPTCADVHISYLPLAHMFERMVQSVVYCHGGRVGFFQGDIRLLSDDMKALCP
TIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHV
GAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGD
IGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGI
VVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHS
DMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacaggagatcctgaggatactgcgactgcctgagctaggtgacttgggacag
tttttccgcagcctctcggccaccaccctcgtgagtatgggtgccctggctgccatcctt
gcctactggttcactcaccggccaaaggccttgcagccgccatgcaacctcctgatgcag
tcagaagaagtagaggacagtggcggggcacggcgatctgtgattgggtctggccctcag
ctacttacccactactatgatgatgcccggaccatgtaccaggtgttccgccgtgggctt
agcatctcagggaatgggccctgtcttggtttcaggaagcctaagcagccttaccagtgg
ctgtcctaccaggaggtggccgacagggctgaatttctggggtccggacttctccagcac
aattgtaaagcatgcactgatcagtttattggtgtttttgcacaaaatcggccagagtgg
atcattgtggagctggcctgctacacatattccatggtggtggtcccgctctatgacacc
ctgggccctggggctatccgctacatcatcaatacagcggacatcagcaccgtgattgtg
gacaaacctcagaaggctgtgcttctgctagagcatgtggagaggaaggagactccaggc
ctcaagctgatcatcctcatggacccattcgaagaagccctgaaagagagagggcagaag
tgcggggtggtcattaagtccatgcaggccgtggaggactgtggccaagagaatcaccag
gctcctgtgcccccgcagcctgatgacctctccattgtgtgtttcacaagcggcacgaca
gggaacccaaaaggtgcgatgctcacccatgggaacgtggtggctgatttctcaggcttt
ctgaaagtgacagagagtcagtgggctcccacttgtgcggatgtgcacatttcctatttg
cctttagcacacatgtttgagcgaatggtgcagtctgtcgtctattgccacggagggcgt
gttggcttcttccagggagatatccgccttctctcagatgacatgaaggctctatgcccc
accatcttccctgtggtcccacgactgctgaaccggatgtacgacaagatcttcagccag
gcaaacacaccattaaagcgctggctcctggagtttgcagcaaagcgtaagcaagccgag
gtccggagtggaatcatcaggaatgatagtatctgggatgaactcttctttaataagatt
caggccagtcttggtgggtgtgtgcggatgattgttactggagcagccccagcatcacca
acagttctgggatttctccgggcagctctagggtgccaggtttatgaaggttatggccaa
actgagtgcacagctggatgtaccttcaccactcctggcgactggacctcagggcacgta
ggggcgccacttccctgcaatcatatcaagctcgttgatgttgaggaactgaactactgg
gcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtgttcaaaggctacttg
aaagatccagacaggacgaaggaggccctggacagcgatggctggcttcacactggagac
atcggaaaatggctgccggcaggaactcttaaaattattgatcggaaaaagcatatattt
aaacttgctcagggagaatatgttgcacccgagaagattgagaacatctacatccggagc
caacctgtggcgcaaatctatgtccatggggacagcttaaaggcctttttggtaggcatt
gttgtgcctgaccctgaagttatgccctcctgggcccagaagagaggaattgaaggaaca
tatgcagatctctgcacaaataaggatctgaagaaagccattttggaagatatggtgagg
ttaggaaaagaaagtggactccattcttttgagcaggttaaagccattcacatccattct
gacatgttctcagttcaaaatggcttgctgacaccaacactaaaagctaagagacctgag
ctgagagagtacttcaaaaaacaaatagaagagctttactcaatctccatgtga

DBGET integrated database retrieval system