KEGG   Homo sapiens (human): 2331
Entry
2331              CDS       T01001                                 

Symbol
FMOD, FM, SLRR2E
Name
(RefSeq) fibromodulin
  KO
K08121  fibromodulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    2331 (FMOD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    2331 (FMOD)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    2331 (FMOD)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_1 LRR_5
Other DBs
NCBI-GeneID: 2331
NCBI-ProteinID: NP_002014
OMIM: 600245
HGNC: 3774
Ensembl: ENSG00000122176
Vega: OTTHUMG00000035910
Pharos: Q06828(Tbio)
UniProt: Q06828 A0A024R971 Q12833 B3KS64
Structure
PDB: 
5MX0

Position
1q32.1
AA seq 376 aa
MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEG
PAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSI
QEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM
PADAPLCLRLASLIEI
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcagtggacctccctcctgctgctggcagggctcttctccctctcccaggcccagtat
gaagatgaccctcattggtggttccactacctccgcagccagcagtccacctactacgat
ccctatgacccttacccgtatgagacctacgagccttacccctatggggtggatgaaggg
ccagcctacacctacggctctccatcccctccagatccccgcgactgcccccaggagtgc
gactgcccacccaacttccccacggccatgtactgtgacaatcgcaacctcaagtacctg
cccttcgttccctcccgcatgaagtatgtgtacttccagaacaaccagatcacctccatc
caggaaggcgtctttgacaatgccacagggctgctctggattgctctccacggcaaccag
atcaccagtgataaggtgggcaggaaggtcttctccaagctgaggcacctggagaggctg
tacctggaccacaacaacctgacccggatgcccggtcccctgcctcgatccctgagagag
ctccatctcgaccacaaccagatctcacgggtccccaacaatgctctggaggggctggag
aacctcacggccttgtacctccaacacaatgagatccaggaagtgggcagttccatgagg
ggcctccggtcactgatcttgctggacctgagttataaccaccttcggaaggtgcctgat
gggctgccctcagctcttgagcagctgtacatggagcacaacaatgtctacaccgtcccc
gatagctacttccggggggcgcccaagctgctgtatgtgcggctgtcccacaacagtcta
accaacaatggcctggcctccaacaccttcaattccagcagcctccttgagctagacctc
tcctacaaccagctgcagaagatccccccagtcaacaccaacctggagaacctctacctc
caaggcaataggatcaatgagttctccatcagcagcttctgcaccgtggtggacgtcgtg
aacttctccaagctgcaggtgctgcgcctggacgggaacgagatcaagcgcagcgccatg
cctgccgacgcgcccctctgcctgcgccttgccagcctcatcgagatctga

DBGET integrated database retrieval system