KEGG   Homo sapiens (human): 23310
Entry
23310             CDS       T01001                                 

Gene name
NCAPD3, CAP-D3, CAPD3, MCPH22, hCAP-D3, hHCP-6, hcp-6
Definition
(RefSeq) non-SMC condensin II complex subunit D3
  KO
K11491  condensin-2 complex subunit D3
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23310 (NCAPD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin II
    23310 (NCAPD3)
SSDB
Motif
Pfam: Cnd1 HEAT HEAT_2 Adaptin_N CLASP_N Cnd3 DUF3013 Cohesin_HEAT VHS
Other DBs
NCBI-GeneID: 23310
NCBI-ProteinID: NP_056076
OMIM: 609276
HGNC: 28952
Ensembl: ENSG00000151503
Vega: OTTHUMG00000167172
Pharos: P42695(Tbio)
UniProt: P42695
Position
11q25
AA seq 1498 aa
MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYES
LLPFATGEHGSMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLY
FLLLEVPGSVANQVFHPVMFDKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRG
KPPRREDIEMDEIIEEQEDENICFSARDLSQIRNAIFHLLKNFLRLLPKFSLKEKPQCVQ
NCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYGLYLLCSPIHGEGDKVISCVF
HQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIFPVVRILLQHI
CAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALL
ELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSAS
ESILELLINSPTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGER
CVMAMLRRRIRDEKTNVRKSALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQAL
QSLTELLMAQPRCVQIQKAWLRGVVPVVMDCESTVQEKALEFLDQLLLQNIRHHSHFHSG
DDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSPTFINNVISHTGTEHSAPAWM
LLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDA
VKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVL
KENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSE
APASQPPPQVRGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNN
VIIVMCDLCIRYTIMVDKYIPNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFR
FVSTLIDSHPDIASFGEFCLAHLLLKRNPVMFFQHFIECIFHFNNYEKHEKYNKFPQSER
EKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKICLSILACFADGILPLDLDASE
LLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIEN
IIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQ
EQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRA
SAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTL
NSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSS
AKEKIEGRSQGNDILCLSLPDKPPPQPQQWNVRSPARNKDTPACSRRSLRKTPLKTAN
NT seq 4497 nt   +upstreamnt  +downstreamnt
atggtggcgttgcggggccttggtagcggcctgcagccctggtgtccgctggatcttaga
ctcgaatgggttgacacagtgtgggaactggatttcacagagactgagcctttggatccc
agcatagaagcagagatcatagagactggattggctgcattcacaaaactctatgaaagc
cttttaccctttgctactggagaacatggatctatggagagtatctggaccttcttcatt
gagaacaatgtttcccatagtacactggtggcattgttctatcattttgttcaaatagtt
cataagaagaatgtcagtgtacagtatcgagaatatggccttcatgccgctgggctttac
tttttgctactagaagtaccaggcagtgtagccaatcaagtattccacccagtgatgttt
gacaaatgcattcagactctaaagaagagctggccccaggaatctaacttgaatcggaaa
agaaagaaagaacagcctaagagctctcaggctaaccccgggaggcatagaaaaagggga
aagccacccaggagagaagatattgagatggatgaaattatagaagaacaagaagatgag
aatatttgtttttctgcccgggacctttctcaaattcgaaatgccatctttcacctttta
aagaattttttaaggcttctgccaaagttttccttgaaagaaaagccacaatgtgtacag
aattgtatagaggtctttgtttcattaactaattttgagccagttcttcatgaatgtcat
gttacacaagccagagctcttaaccaagcaaaatacataccagaactggcttattatgga
ttgtatttgctgtgctctcccattcatggagaaggagataaggtcatcagttgtgttttc
catcaaatgctcagtgtaatattaatgttagaagttggtgaaggatcccatcgtgccccc
cttgctgttacctcccaagtcatcaactgtagaaaccaggcggtccagtttatcagcgcc
cttgtggatgaattaaaggagagtatattcccagtcgtccgtatcttactgcagcacatc
tgtgccaaggtggtagataaatcagagtatcgtacttttgcagcccagtccctagtccag
ctgctcagtaaacttccttgtggggaatacgctatgttcattgcctggctttacaaatac
tcccgaagttccaagatcccacaccgggtttttactcttgatgttgtcttagctctgtta
gaactgcctgaaagagaggtggataacaccctctccttggagcatcagaagttcttaaag
cataagttcctggtgcaggaaattatgtttgatcgttgcttagacaaggcgcctactgtc
cgcagcaaggcactgtccagctttgcacactgtctggagttgactgttaccagtgcgtcg
gagagtatcctggagctcctgattaacagtcctacgttttctgtaatagagagtcaccct
ggtaccttactgagaaattcatcagctttttcctaccaaaggcagacatctaaccgttcc
gaaccctcaggggagatcaacatagacagcagtggtgaaacagttggatctggagaaaga
tgtgtcatggcaatgctgagaaggaggatcagggatgagaagaccaacgttaggaagtct
gcactgcaggtattagtgagtattttgaaacactgtgatgtctcaggcatgaaggaagac
ctgtggattctgcaggaccagtgtcgggaccctgcagtgtctgtccggaagcaggccctc
cagtctcttactgaactccttatggctcagcctagatgcgtgcagatccagaaagcctgg
ttgcggggggtggtcccggtggtgatggactgcgagagcactgtgcaggagaaggccctg
gagttcctggaccagctgctgctgcagaacatccggcatcacagtcattttcactctggg
gacgacagccaggtcctcgcctgggcgcttcttactctcctcaccaccgaaagccaggaa
ctgagccgatatttaaataaggcttttcatatctggtccaagaaagaaaaattctcaccc
acttttataaacaatgtaatatctcacactggcacggaacattcggcacctgcctggatg
ctgctctccaagattgctggctcctcacccaggctggactacagcagaataatacaatct
tgggagaaaatcagcagtcagcagaatcccaattcaaacaccttaggacatattctctgt
gtgattgggcatattgcaaagcatcttcctaagagcacccgggacaaagtgactgatgct
gtcaagtgtaagctgaatggatttcagtggtctctagaggtgatcagttcagctgttgac
gccttgcagaggctttgtagagcatctgcagagacaccagcagaggagcaggaattgctg
acgcaggtgtgtggggatgtactctccacctgcgagcaccgcctctccaacatcgttctc
aaggagaatggaacagggaatatggacgaagacctgttggtgaagtacatttttacctta
ggggatatagcccagctgtgtccagccagggtggagaagcgcatcttccttctgattcag
tccgtcctggcttcgtctgctgatgctgaccactcaccatcatctcaaggcagcagtgag
gccccagcgtctcagccacccccccaggtcagaggttctgtcatgccctctgtgattaga
gcacatgccatcattaccttaggtaagctgtgcttacagcacgaggatctggcaaagaag
agcatcccagccctggtgcgagagctcgaggtgtgtgaggacgtggctgtccgcaacaac
gtcatcattgtaatgtgcgatctctgcattcgctacaccatcatggtggacaagtatatt
cccaacatctccatgtgtctgaaggattccgacccattcatccggaagcagacactcatc
ttgcttaccaatctcttgcaggaggaatttgtgaaatggaagggctccctgttcttccga
tttgtcagcactctgatcgattcacacccagacattgccagcttcggggagttttgcctg
gctcacctgttactgaagaggaaccctgtcatgttcttccaacacttcattgaatgtatt
tttcactttaataactatgagaagcatgagaagtacaacaagttcccccagtcagagaga
gagaagcggctgttttcattgaagggaaagtcaaacaaagagagacgaatgaaaatctac
aaatttcttctagagcacttcacagatgaacagcgattcaacatcacttccaaaatctgc
cttagtattttggcgtgctttgctgatggcatcctacccctggacctggacgccagtgag
ttactctcagacacgtttgaggtcctcagctcaaaggagatcaagcttttggcaatgaga
tctaaaccagacaaagacctccttatggaagaagatgacatggccttggcaaatgtagtc
atgcaggaagctcagaagaagctcatctcacaagttcagaagaggaatttcatagaaaat
attattccaattatcatctccctgaagactgtgctggagaaaaataagatcccagctttg
cgggaactcatgcactatctcagggaggtgatgcaggattaccgagatgagctcaaggac
ttctttgcagttgacaaacagctggcatcagagcttgagtatgacatgaagaagtaccag
gaacagctggtccaggagcaggagctagcaaaacatgcagatgtggccgggacggctgga
ggtgctgaggtggcacctgtggcacaggttgccctgtgtttagaaacagtgccagttcct
gctggccaagaaaaccctgccatgtcacctgccgtgagccagccctgcacacccagggca
agtgctggccatgtagcagtatcatctcctacacctgaaacagggccattgcagaggttg
ctgcccaaagccaggcccatgtccctgagcaccattgcaatcctgaattctgtcaagaaa
gccgtggagtcaaagagcaggcatcggagtcggagcttaggagtgctgcctttcacttta
aattctggaagcccagaaaaaacgtgcagtcaggtgtcttcatacagtttggagcaagag
tcgaatggcgagattgagcacgtgaccaagcgggccatcagcacccccgagaagagcatc
agtgatgtcacgtttggagcaggggtcagttacatcgggacaccacggactccgtcgtca
gccaaagagaaaattgaaggccggagtcaaggaaatgacatcttatgtttatcactgcct
gataaaccgcccccacagcctcagcagtggaatgtgcggtctcccgccaggaataaagac
actccagcctgcagcaggaggtccctccgaaagacccctctgaaaacagccaactaa

DBGET integrated database retrieval system