KEGG   Homo sapiens (human): 23313Help
Entry
23313             CDS       T01001                                 

Gene name
C22orf9, LSC3
Definition
(RefSeq) KIAA0930
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2045
Motif
Other DBs
NCBI-GeneID: 23313
NCBI-ProteinID: NP_001009880
HGNC: 1314
Ensembl: ENSG00000100364
Vega: OTTHUMG00000151263
UniProt: Q6ICG6
Position
22q13.31
AA seq 404 aa AA seqDB search
MLRAIAEERGRLSLRREVCGLGCFKDDRIVFWTWMFSTYFMEKWAPRQDDMLFYVRRKLA
YSGSESGADGRKAAEPEVEVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCA
VCTRADGGDIHIHKKKSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVG
EGEMVCVELVASDKTNTFQGVIFQGSIRYEALKKVYDNRVSVAARMAQKMSFGFYKYSNM
EFVRMKGPQGKGHAEMAVSRVSTGDTSPCGTEEDSSPASPMHERVTSFSTPPTPERNNRP
AFFSPSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSGTGRSLV
GSWLKLNRADGNFLLYAHLTYVTLPLHRILTDILEVRQKPILMT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtgccatagcggaggagcgcggccgtcttagcctgcgccgcgaggtctgcggc
ctcgggtgcttcaaggatgaccgcatcgtcttctggacttggatgttctccacctacttc
atggagaaatgggctccccggcaggacgacatgcttttctatgtgcgccggaagctggcg
tactccggcagcgaaagcggtgcagacgggaggaaggcagctgagcctgaggtggaggtg
gaggtgtaccggcgggactccaagaagctgccaggcctgggagaccctgacatcgactgg
gaggagagcgtctgcctgaatctcatcctgcagaagctggactacatggtgacctgtgcg
gtgtgcacacgtgctgacggcggggacattcacatccataagaagaaatctcagcaagtg
ttcgcgtcccccagtaaacaccccatggacagcaagggggaggagtccaagatcagctac
cccaacatcttcttcatgattgacagcttcgaggaggtgttcagcgacatgaccgtaggg
gaaggagagatggtctgtgtggagctggtggctagtgacaaaaccaacacgttccagggg
gtcatctttcagggctccatccgctacgaggcgctcaagaaggtgtatgacaaccgggtg
agcgtggccgcccgcatggcacagaagatgtcgtttggcttctacaagtacagcaacatg
gagtttgtgcgcatgaagggcccccagggcaagggccacgccgagatggcggtcagccga
gtgtctacaggtgacacatccccctgtgggactgaagaggactccagcccagcttcgccc
atgcacgagcgggtgacctccttcagcacaccccccaccccagaacggaacaaccggcct
gccttcttctccccatccctcaagaggaaggtgccccggaaccggatcgctgagatgaag
aagtcgcactcggccaacgacagcgaggagttcttccgggaggacgacggtggagccgat
ctgcacaatgcaaccaacctgcggtctcggtccctgtcgggcacaggacggtccctggtc
gggtcctggctgaagctgaacagagcagatggaaacttccttctctatgcacacttaacc
tacgtcacgttgccgctgcatcggattttaacagacatcctggaagttcggcagaagccc
atcctgatgacctag

DBGET integrated database retrieval system