KEGG   Homo sapiens (human): 23314
Entry
23314             CDS       T01001                                 

Gene name
SATB2, GLSS
Definition
(RefSeq) SATB homeobox 2
  KO
K23226  DNA-binding protein SATB2
Organism
hsa  Homo sapiens (human)
Disease
H02146  Glass syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23314 (SATB2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    23314 (SATB2)
SSDB
Motif
Pfam: CUTL CUT ULD Homeodomain
Other DBs
NCBI-GeneID: 23314
NCBI-ProteinID: NP_001165980
OMIM: 608148
HGNC: 21637
Ensembl: ENSG00000119042
Vega: OTTHUMG00000132767
Pharos: Q9UPW6(Tbio)
UniProt: Q9UPW6 A0A024R3U6 B3KPQ9
Structure
PDB: 
2CSF 1WI3 1WIZ

Position
2q33.1
AA seq 733 aa
MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARGRPNGAVAKAVGGLMI
PVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGIIKL
GRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLEDLPAEQWNHATVRNALK
ELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERE
NLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP
QLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVKPEPTNSSVEV
SPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQN
FLNLPEVERDRIYQDERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGAN
INITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCT
IRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLPPEPVQVLHRQQSQPAKESSPPREEA
PPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTII
KFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENA
DKSKAAPAEIDQR
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggagcggcggagcgagagcccgtgtctgcgggacagccccgaccggcggagcggcagc
ccggacgtcaaggggcctcccccagtgaaggtggcccggctggagcagaacggcagcccc
atgggagcccgcgggaggcccaacggcgccgtggccaaggccgtgggaggtttgatgatt
cctgtcttttgtgtcgtggagcagttggacggctctcttgaatatgacaacagagaagaa
cacgccgagtttgtcctggtgcggaaagatgtgctttttagccagctggtggagactgcg
ctcctggccctggggtattctcacagctctgcggcccaggcccaaggaataatcaagctg
ggaaggtggaaccctctccccctcagttatgtgacagatgcacccgacgcgacagtggcc
gacatgctacaagatgtctatcatgttgtgacgttgaaaatccaattacaaagttgttca
aagttggaagacttgcctgcggagcagtggaaccatgccacagtccgcaatgccttaaag
gaactgctcaaagagatgaaccagagcacattagccaaagaatgccctctctcccagagt
atgatttcatccattgtaaatagcacatattatgccaatgtgtcagcaaccaagtgccag
gagtttgggagatggtataaaaagtacaagaagattaaagtggaaagagtggaacgagaa
aacctttcagactattgtgttctgggccagcgtccaatgcatttaccaaatatgaaccag
ctggcatccctggggaaaaccaacgaacagtctcctcacagccaaattcaccacagtact
ccaatccgaaaccaagtgcccgcattacagcccatcatgagccctggtcttctttctccc
cagcttagtccacaacttgtaaggcaacaaatagccatggcccatctgataaaccaacag
attgccgttagccggctcctggctcaccagcatcctcaagccatcaaccagcagttcctg
aaccatccacccatccccagagcagttaagccagagccaaccaactcttccgtggaagtc
tctccagatatctaccagcaagtcagagatgagctgaagagggccagtgtgtcccaagct
gtctttgcaagagtggcattcaaccgcacacagggattgttgtctgagattctgcgtaag
gaagaagaccctcggacagcctctcagtctcttctagtaaacctgagggccatgcagaat
ttcctcaatctgccagaagtggagcgagatcgcatctaccaggatgagagggagcggagc
atgaatcccaatgtgagcatggtctcctcggcctccagcagtcccagctcctcccgaacc
cctcaggccaaaacctcgacaccgacaacagacctccctattaaggtggacggcgccaac
atcaacatcacagctgccatttatgacgagatccaacaggagatgaaaagggccaaggtg
tctcaagccctgtttgccaaagtggctgcaaataaaagtcagggctggctgtgtgaactg
ctccgctggaaggagaacccaagcccagaaaaccgcaccctctgggaaaacctctgtacc
atccgtcgcttcctgaaccttccccagcatgagagggatgtcatctatgaggaggagtca
aggcatcaccacagcgaacgcatgcaacacgtggtccagcttccccctgagccggtgcag
gtacttcatagacagcagtctcagccagccaaggagagttcccctcccagagaagaagcg
cctcccccacctcctccgactgaagacagttgtgccaaaaagccccggtctcgcacaaag
atctccttagaagccctggggatcctccaaagctttattcatgatgtaggcctgtaccca
gaccaggaagccatccacactctttcggctcagctggatctccccaaacacaccatcatc
aagttcttccagaaccagcggtaccacgtgaagcaccacgggaagctgaaagagcacctg
ggctccgcggtggacgtggctgaatataaggacgaggagctgctgaccgagtcagaggag
aacgacagcgaggaaggctccgaggagatgtacaaagtggaggctgaggaggaaaatgct
gacaaaagcaaggcagcacctgccgaaattgaccagagataa

DBGET integrated database retrieval system