KEGG   Homo sapiens (human): 23315Help
Entry
23315             CDS       T01001                                 

Gene name
SLC9A8, NHE-8, NHE8
Definition
(RefSeq) solute carrier family 9 member A8
  KO
K14724  solute carrier family 9 (sodium/hydrogen exchanger), member 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23315 (SLC9A8)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   23315 (SLC9A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-GeneID: 23315
NCBI-ProteinID: NP_056081
OMIM: 612730
HGNC: 20728
Ensembl: ENSG00000197818
Vega: OTTHUMG00000032710
Pharos: Q9Y2E8(Tbio)
UniProt: Q9Y2E8
Position
20q13.13
AA seq 581 aa AA seqDB search
MGEKMAEEERFPNTTHEGFNVTLHTTLVVTTKLVLPTPGKPILPVQTGEQAQQEEQSSGM
TIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAVIKIIEFKKLANWKEEEM
FRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQAD
VISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVFGESILNDAVSIVLTNTA
EGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISALVLKHIDLRKTPSLEFG
MMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPVTQILMQQTLRTVAFLCET
CVFAFLGLSIFSFPHKFEISFVIWCIVLVLFGRAVNIFPLSYLLNFFRDHKITPKMMFIM
WFSGLRGAIPYALSLHLDLEPMEKRQLIGTTTIVIVLFTILLLGGSTMPLIRLMDIEDAK
AHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFT
RRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagatggcggaagaggagaggttccccaatacaactcatgagggtttcaat
gtcaccctccacaccaccctggttgtcacgacgaaactggtgctcccgacccctggcaag
cccatcctccccgtgcagacaggggagcaggcccagcaagaggagcagtccagcggcatg
accattttcttcagcctccttgtcctagctatctgcatcatattggtgcatttactgatc
cgatacagattacatttcttgccagagagtgttgctgttgtttctttaggtattctcatg
ggagcagttataaaaattatagagtttaaaaaactggcgaattggaaggaagaagaaatg
tttcgtccaaacatgtttttcctcctcctgcttccccctattatctttgagtctggatat
tcattacacaagggtaacttctttcaaaatattggttccatcaccctgtttgctgttttt
gggacggcaatctccgcttttgtagtaggtggaggaatttattttctgggtcaggctgat
gtaatctctaaactcaacatgacagacagttttgcgtttggctccctaatatctgctgtc
gatccagtggccactattgccattttcaatgcacttcatgtggaccccgtgctcaacatg
ctggtctttggagaaagtattctcaacgatgcagtctccattgttctgaccaacacagct
gaaggtttaacaagaaaaaatatgtcagatgtcagtgggtggcaaacatttttacaagcc
cttgactacttcctcaaaatgttctttggctctgcagcgctcggcactctcactggctta
atttctgcattagtgctgaagcatattgacttgaggaaaacgccttccttggagtttggc
atgatgatcatttttgcttatctgccttatgggcttgcagaaggaatctcactctcaggc
atcatggccatccttttctcaggcatcgtgatgtcccactacacgcaccataacctctcc
ccagtcacccagatcctcatgcagcagaccctccgcaccgtggccttcttatgtgaaaca
tgtgtgtttgcatttcttggcctgtccatttttagttttcctcacaagtttgaaatttcc
tttgtcatctggtgcatagtgcttgtactatttggcagagcggtaaacattttccctctt
tcctacctcctgaatttcttccgggatcataaaatcacaccgaagatgatgttcatcatg
tggtttagtggcctgcggggagccatcccctatgccctgagcctacacctggacctggag
cccatggagaagcggcagctcatcggcaccaccaccatcgtcatcgtgctcttcaccatc
ctgctgctgggcggcagcaccatgcccctcattcgcctcatggacatcgaggacgccaag
gcacaccgcaggaacaagaaggacgtcaacctcagcaagactgagaagatgggcaacact
gtggagtcggagcacctgtcggagctcacggaggaggagtacgaggcccactacatcagg
cggcaggaccttaagggcttcgtgtggctggacgccaagtacctgaaccccttcttcact
cggaggctgacgcaggaggacctgcaccacgggcgcatccagatgaaaactctcaccaac
aagtggtacgaggaggtacgccagggcccctccggctccgaggacgacgagcaggagctg
ctctga

DBGET integrated database retrieval system