KEGG   Homo sapiens (human): 23331
Entry
23331             CDS       T01001                                 

Gene name
TTC28, TPRBK
Definition
(RefSeq) tetratricopeptide repeat domain 28
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TPR_12 TPR_7 TPR_1 CHAT TPR_2 TPR_8 TPR_10 TPR_MalT TPR_14 Rapsyn_N TPR_11 TPR_19 RPN7 TPR_9 TPR_16 TPR_17 TPR_6 ANAPC5
Other DBs
NCBI-GeneID: 23331
NCBI-ProteinID: NP_001138890
OMIM: 615098
HGNC: 29179
Ensembl: ENSG00000100154
Vega: OTTHUMG00000151006
Pharos: Q96AY4(Tdark)
UniProt: Q96AY4
Position
22q12.1
AA seq 2481 aa
MEQSPPPAPEPTQGPTPARSRRRREPESPPASAPIPLFGADTIGQRSPDGPVLSKAEFVE
KVRQSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDDAIKARL
LNPKWPKAYFRQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRDSLE
PTYQQLQKMKLDKSPFVVVSVVGQELLTAGHHGASVVVLEAALKIGTCSLKLRGSVFSAL
SSAYWSLGNTEKSTGYMQQDLDVAKTLGDQTGECRAHGNLGSAFFSKGNYREALTNHRHQ
LVLAMKLKDREAASSALSSLGHVYTAIGDYPNALASHKQCVLLAKQSKDELSEARELGNM
GAVYIAMGDFENAVQCHEQHLKIAKDLGNKREEARAYSNLGSAYHYRRNFDKAMSYHNYV
LELAQELMEKAIEMRAYAGLGHAARCMQDLERAKQYHEQQLGIAEDLKDRAAEGRASSNL
GIIHQMKGDYDTALKLHKTHLCIAQELSDYAAQGRAYGNMGNAYNALGMYDQAVKYHRQE
LQISMEVNDRASQASTHGNLAVAYQALGAHDRALQHYQNHLNIARELRDIQSEARALSNL
GNFHCSRGEYVQAAPYYEQYLRLAPDLQDMEGEGKVCHNLGYAHYCLGNYQEAVKYYEQD
LALAKDLHDKLSQAKAYCNLGLAFKALLNFSKAEECQKYLLSLAQSLNNSQAKFRALGNL
GDIFICKKDINGAIKFYEQQLGLAHQVKDRRLEASAYAALGTAYRMIQKYDKALGYHTQE
LEVYQELSDLPGECRAHGHLAAVYMALGKYTMAFKCYEEQLDLGQKLKDPSLEAQVYGNM
GITKMNMNVMEEAIGYFEQQLAMLQQLSGNESVLDRGRAYGNLGDCYEALGDYEEAIKYY
EQYLSVAQSLNRMQDQAKAYRGLGNGHRAMGSLQQALVCFEKRLVVAHELGEAFNKAQAY
GELGSLHSQLGNYEQAISCLERQLNIARDMKDRALESDAACGLGGVYQQMGEYDTALQYH
QLDLQIAEETNNPTCQGRAYGNLGLTYESLGTFERAVVYQEQHLSIAAQMNDLAAKTVSY
SSLGRTHHALQNYSQAVMYLQEGLRLAEQLGRREDEAKIRHGLGLSLWASGNLEEAQHQL
YRASALFETIRHEAQLSTDYKLSLFDLQTSSYQALQRVLVSLGHHDEALAVAERGRTRAF
ADLLVERQTGQQDSDPYSPVTIDQILEMVNGQRGLVLYYSLAAGYLYSWLLAPGAGIVKF
HEHYLGENTVENSSDFQASSSVTLPTATGSALEQHIASVREALGVESHYSRACASSETES
EAGDIMDQQFEEMNNKLNSVTDPTGFLRMVRRNNLFNRSCQSMTSLFSNTVSPTQDGTSS
LPRRQSSFAKPPLRALYDLLIAPMEGGLMHSSGPVGRHRQLILVLEGELYLIPFALLKGS
SSNEYLYERFGLLAVPSIRSLSVQSKSHLRKNPPTYSSSTSMAAVIGNPKLPSAVMDRWL
WGPMPSAEEEAYMVSELLGCQPLVGSVATKERVMSALTQAECVHFATHISWKLSALVLTP
SMDGNPASSKSSFGHPYTIPESLRVQDDASDGESISDCPPLQELLLTAADVLDLQLPVKL
VVLGSSQESNSKVTADGVIALTRAFLAAGAQCVLVSLWPVPVAASKMFIHAFYSSLLNGL
KASAALGEAMKVVQSSKAFSHPSNWAGFMLIGSDVKLNSPSSLIGQALTEILQHPERARD
ALRVLLHLVEKSLQRIQNGQRNAMYTSQQSVENKVGGIPGWQALLTAVGFRLDPPTSGLP
AAVFFPTSDPGDRLQQCSSTLQSLLGLPNPALQALCKLITASETGEQLISRAVKNMVGML
HQVLVQLQAGEKEQDLASAPIQVSISVQLWRLPGCHEFLAALGFDLCEVGQEEVILKTGK
QANRRTVHFALQSLLSLFDSTELPKRLSLDSSSSLESLASAQSVSNALPLGYQQPPFSPT
GADSIASDAISVYSLSSIASSMSFVSKPEGGSEGGGPGGRQDHDRSKNAYLQRSTLPRSQ
LPPQTRPAGNKDEEEYEGFSIISNEPLATYQENRNTCFSPDHKQPQPGTAGGMRVSVSSK
GSISTPNSPVKMTLIPSPNSPFQKVGKLASSDTGESDQSSTETDSTVKSQEESNPKLDPQ
ELAQKILEETQSHLIAVERLQRSGGQVSKSNNPEDGVQAPSSTAVFRASETSAFSRPVLS
HQKSQPSPVTVKPKPPARSSSLPKVSSGYSSPTTSEMSIKDSPSQHSGRPSPGCDSQTSQ
LDQPLFKLKYPSSPYSAHISKSPRNMSPSSGHQSPAGSAPSPALSYSSAGSARSSPADAP
DIDKLKMAAIDEKVQAVHNLKMFWQSTPQHSTGPMKIFRGAPGTMTSKRDVLSLLNLSPR
HNKKEEGVDKLELKELSLQQHDGAPPKAPPNGHWRTETTSLGSLPLPAGPPATAPARPLR
LPSGNGYKFLSPGRFFPSSKC
NT seq 7446 nt   +upstreamnt  +downstreamnt
atggagcagtcgccgccgccggcgcccgagccgacccaagggccgacccccgcaaggagc
cgaaggcggcgggagccagagtcgccgccggcgtcggcgccgattcctctctttggtgct
gacactattggccagagaagtcctgatggaccggtactgagcaaagctgaatttgttgag
aaagttcgtcagagtaatcaggcctgtcatgatggagatttccacacagctattgttctg
tataatgaagccctggctgttgaccctcagaactgcatcttatacagcaatagatctgca
gcctacatgaaaatccagcagtatgacaaggcactggatgatgcaatcaaagctcgactt
ctcaatcccaagtggccaaaggcatacttccgacagggtgttgccctccagtaccttgga
cgtcatgccgatgccctggcagcctttgcatctggactggctcaagaccccaagagtctc
cagcttctggtggggatggtggaagccgccatgaaatctcccatgagagactccctcgag
cccacttatcagcagcttcagaaaatgaaactggacaagagtccctttgtggtcgtgtct
gtggttgggcaggaactcctgacagctggccatcatggggcctctgtggttgtcttagaa
gccgcactgaagattggcacctgcagcctcaaactgagaggttctgttttctctgccctg
agcagtgcttactggtctcttggaaatacagagaagagcaccggatatatgcagcaggac
ttggatgtagccaagaccttaggtgaccagacaggagaatgccgagctcatgggaatctg
ggctctgcattcttctccaaaggaaattaccgggaggctctcactaaccacaggcatcag
ttggtactcgccatgaaactcaaagatcgagaggcagcttcatcagccttgagcagtctg
ggccacgtgtacacagccattggagactaccccaatgcactggccagtcacaaacagtgt
gttcttcttgccaagcaatccaaagatgaactttctgaagcccgagaacttggcaacatg
ggagctgtgtatattgccatgggtgactttgagaatgctgtgcagtgccatgagcagcat
ctgaagatagccaaggacctggggaacaagcgagaagaggcccgggcttatagcaacctg
ggcagtgcctatcactaccggaggaactttgacaaggccatgtcttaccataactatgtc
ctggagctggcacaggagttgatggagaaggctattgagatgcgggcctatgctggacta
ggccatgctgccaggtgcatgcaggatttggagagagctaaacaataccatgagcagcag
ctgggcattgctgaggatctcaaggaccgggctgcagaggggcgagcatcctccaatcta
ggaatcatacaccagatgaaaggtgattatgacactgcactgaaactccacaagacccac
ctgtgcattgcccaggagctgagtgattatgctgcccagggccgtgcctatgggaatatg
ggcaatgcctacaatgccctgggcatgtacgaccaggcggtcaaataccatcggcaggag
ctgcagatctccatggaagtgaatgaccgcgcctcacaggcctccacacatgggaacctt
gccgtggcctaccaggccctgggtgcccatgaccgggccctgcaacactatcagaaccac
ttgaacatcgcccgggagctacgagacatccagagcgaggcccgggccctcagcaacctg
ggcaatttccactgctctcggggagagtatgtccaggctgccccctattatgaacagtac
ctccggcttgctcccgaccttcaagacatggaaggagaagggaaggtctgccacaatctt
ggctatgcccattactgccttggaaactatcaggaggcagtgaagtactacgaacaggat
ctggcactggctaaagaccttcacgacaagttgagccaagcaaaagcctactgcaacttg
ggcctagcattcaaggctctgctgaatttcagtaaagctgaagagtgtcagaagtaccta
ctgtccctagcccagtctctgaataattcccaggctaaatttcgagccctaggaaacctg
ggcgatatattcatctgtaaaaaagatataaatggtgcaataaaattctatgagcagcaa
ctgggcttagctcaccaggtaaaggacagaagattagaagccagtgcatatgcagccctg
ggcactgcataccgaatgatccagaagtatgacaaggccctgggttatcacacacaggaa
ctggaggtatatcaggagctgagtgacttgccaggggagtgcagagctcatgggcacctg
gctgctgtctacatggcccttgggaaatacacaatggcattcaagtgttatgaagagcaa
ctggatctagggcaaaagctgaaggatccgagtctggaagcccaggtctatggcaacatg
ggcatcacaaagatgaacatgaatgtgatggaagaagccattggctactttgagcagcaa
ttggccatgctgcagcagctaagtggaaatgagtctgtgctcgacaggggccgggcctat
ggcaacctgggggattgctacgaagccctgggtgactatgaggaagctatcaaatactat
gaacaatatttatctgtcgcgcagagtctgaatcgcatgcaagaccaagccaaggcttac
cggggcctgggaaatggacacagggcaatggggagcttgcagcaagcccttgtgtgcttt
gaaaagaggctcgtggttgctcatgaacttggagaggccttcaataaagcccaggcctat
ggagagctgggaagtctgcacagccaattagggaattacgaacaagccatttcctgcctt
gaacgccagctgaacattgctagagatatgaaagaccgagccctggagagtgacgcagcc
tgtggcctggggggcgtttaccagcagatgggggagtatgacacagccctgcagtaccac
cagcttgatctacagatagcagaggaaaccaacaaccccacgtgccagggccgagcctat
gggaacctgggcctgacttatgaatccctgggcaccttcgagagggctgtggtctatcaa
gaacagcacttgagcattgctgcacagatgaatgacttggcggccaagacggtgtcatat
agtagccttggaaggacccatcatgccttgcagaactattcccaagcagtcatgtactta
caggaaggtttaaggttagctgagcaactgggccgaagagaagatgaggcaaaaattcgc
catggccttggcctctccctttgggctagtggaaacttggaggaggcccaacaccagctt
tatagggcatcagccttgtttgaaacaatccgacatgaggcacagctgagcacggactac
aaactctccctctttgacctgcagacatcatcctaccaggccttgcagcgggtgctcgtc
agcctaggccatcatgatgaagccctggctgtggcagaaaggggacggacaagggcattt
gctgatcttctggtggaacgacaaacaggacaacaagactccgacccctactccccagtc
actattgatcagatcttagagatggtaaatggccagaggggactagtgctttactattcc
ctggctgcaggctatctgtatagctggctgctggctcctggggcaggaattgtgaagttt
catgaacactacctgggtgagaacacagtggaaaactcaagtgacttccaggccagcagc
agtgtaacccttccaacagcaaccggctcagccctggagcagcacattgccagtgtccgg
gaggccctgggggtggagtctcactactcaagggcctgtgccagcagtgagacagagagt
gaagcgggagacatcatggaccagcaatttgaagagatgaacaacaaactcaactcggtc
actgaccccactggctttctgcggatggttcgccgcaataacctgtttaacaggagctgc
cagagcatgacgagcctgttcagtaacactgtgtcaccgacccaggacgggacctcctct
cttcccaggaggcagagctcgtttgccaagcccccgctccgtgccctgtatgacctgctc
atcgcgcccatggaagggggcctgatgcactccagcggccccgtgggccggcaccggcag
ctcatcctggttctggagggggagctctacctcattcctttcgccctcctgaagggaagc
tcctccaatgagtacctctacgagcgcttcggcctccttgctgtcccttccatccgctcc
ctcagcgtgcagtccaagtctcacttacggaagaacccgcccacatactccagctccaca
tccatggcggctgtcatcggcaaccccaagctaccatcggccgtgatggacaggtggctg
tgggggcccatgccatcggccgaggaagaggcctacatggtgtccgagctgctgggctgc
cagcccctagtgggcagtgtggccaccaaggagagggtcatgagtgccctgacccaggct
gaatgcgtccactttgccacccacatctcctggaagctgtcggccttggtcctcacgccc
agcatggacggcaaccctgccagcagcaagagctccttcggccacccctacacgatccct
gagtccttgcgggtgcaggacgatgccagtgatggggagagcatctcggactgcccgccc
ctgcaggagctgctgcttactgccgccgacgtcctggacctgcagctgcctgtgaagctg
gtggtgcttggctcctcccaggagtccaacagcaaagtcacagccgacggggtcatcgcg
ctgacaagggccttcctggctgccggcgctcagtgtgtcctcgtgtctctgtggcctgtg
ccagtggctgcttctaagatgttcatccatgccttctactcatccctgctgaacggcctg
aaagccagcgccgccctgggggaggccatgaaggtggtgcagagcagcaaggccttctcg
cacccctccaactgggcagggttcatgctcatcgggagtgacgttaagctgaacagcccc
tcatcactcatcggccaggccctcacagagatcctgcagcacccggagcgtgcgcgggac
gccctgcgagtgctgctgcacctggtggagaaatccctgcagcgcatccagaatgggcag
cgcaatgccatgtacacatcccagcagagtgtggagaacaaagtgggcggcatccctggc
tggcaggccctcctcaccgctgtgggcttccggctggaccccccaaccagtggcctgcca
gcggctgtcttcttcccaacctccgacccgggcgaccggctccagcagtgcagcagcaca
ctccagtccctgctgggtctgcccaatcctgccctccaagccctttgcaaactcatcact
gcctccgagacgggcgagcagctcatcagccgggctgttaaaaatatggttggaatgctc
caccaggtgctggttcagctccaggctggcgagaaggagcaggacttggcatcagctccc
attcaggtctccatcagcgtccagctgtggcggctcccgggatgccacgagttcctggca
gctctaggttttgatctctgtgaagttggtcaggaggaagtaatcctgaaaaccgggaag
caagctaatcgacggactgtgcacttcgcgctccagtccctgctgtctctgtttgattct
actgagctacccaagcgcctcagccttgacagctcctcctccctcgagtctcttgcttct
gctcagtctgtttccaacgccctgcccttgggttaccagcaaccccccttctctcccacc
ggtgcggacagcatcgcctcagatgccatctctgtgtacagtctgagctccattgcctcc
tcaatgagctttgtctccaaacccgagggtggatcagagggtggaggccccggaggacgg
caggaccatgaccggtccaagaacgcttacctgcagagatccaccctgcctaggagccag
ctgcctccccagacccgccctgcaggcaacaaagatgaagaagaatatgaagggttttct
atcatcagtaacgagcccttggcgacctaccaagaaaaccgaaacacatgcttctcacca
gaccacaaacaaccccaacctgggacagccggaggcatgagagtctcggtgagctccaaa
gggagcatcagcactccaaattctccagtgaaaatgactctgattcccagccccaactca
cccttccaaaaggtgggaaaactagcaagctcagatacaggagaatcagaccagtctagc
acagaaacggacagtaccgtgaaatcccaagaagaaagcaacccaaaactggatccacaa
gagttagcccagaaaattctggaggagacacagagtcatctcattgcggtggagcgtctt
cagaggagcggcggccaggtgagcaagagtaataaccctgaagacggcgttcaggcgccc
agcagcactgctgtcttcagagcgtcagaaaccagtgcgttcagcaggcctgttctctcc
catcagaagagtcagccatcaccagtcactgttaaaccaaagcccccagccaggagctcc
tccctgcccaaggtgagttccggatatagcagccccaccacctcagagatgtccatcaaa
gacagcccgagccagcacagtggccggccatcgcccggctgcgactcacagacttcccag
ctggaccagcctctctttaaactgaagtaccccagctctccttacagcgctcacatttcc
aaatcaccaaggaacatgtccccaagctccggccaccagtctcctgctggcagtgcaccc
tccccagctctctcctactcctcagctggatctgctcgctcaagtccagcagacgctccc
gacatagacaaactgaaaatggcagccattgatgaaaaggtgcaggctgtccataacctg
aagatgttctggcagagcacaccccagcattccacagggccaatgaagatcttccggggg
gctcctggcacgatgacttccaaaagggatgtcctcagtctgttgaatttgtcaccacgg
cacaataagaaggaggagggagtggataagcttgaactgaaggagctgtccctgcagcag
catgacggagctccaccgaaagcccctcccaacggacactggcgcaccgagaccacctcg
ctgggctcactgccgctgcccgccggccctcccgccacagcccccgcgcgccctttgagg
cttccttctggaaatggctacaagttcctgtctccaggaagatttttcccttcttccaaa
tgctaa

DBGET integrated database retrieval system