KEGG   Homo sapiens (human): 23332
Entry
23332             CDS       T01001                                 
Symbol
CLASP1, MAST1
Name
(RefSeq) cytoplasmic linker associated protein 1
  KO
K16578  CLIP-associating protein 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23332 (CLASP1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23332 (CLASP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     23332 (CLASP1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      23332 (CLASP1)
SSDB
Motif
Pfam: CLASP_N HEAT HEAT_2 HEAT_EZ Sec7_N Cnd1 RTP1_C1 TFCD_C MMS19_N DUF6700 ParcG TAN
Other DBs
NCBI-GeneID: 23332
NCBI-ProteinID: NP_056097
OMIM: 605852
HGNC: 17088
Ensembl: ENSG00000074054
Pharos: Q7Z460(Tbio)
UniProt: Q7Z460
Structure
Position
2:complement(121337776..121649462)
AA seq 1538 aa
MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVN
SSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMD
QAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPN
SQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSANDKN
FDDEDSVDGNRPSSASSTSSKAPPSSRRNVGMGTTRRLGSSTLGSKSSAAKEGAGAVDEE
DFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYD
NFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPN
SAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSL
ERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL
KNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRS
DIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLGRIRTRRQSSGSATNVASTPDNR
GRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKI
PRSQGCSRETSPNRIGLARSSRIPRPSMSQGCSRDTSRESSRDTSPARGFPPLDRFGLGQ
PGRIPGSVNAMRVLSTSTDLEAAVADALKKPVRRRYEPYGMYSDDDANSDASSVCSERSY
GSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEI
FTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQ
KALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSET
RLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNH
LKNSSNTSVGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSRLWGWSADGLAKHPP
PFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDL
NEPIKRDGKKECDIVSRDGGAASPATEGRGGSEVEGGRTALDNKTSLLNTQPPRAFPGPR
ARDYNPYPYSDAINTYDKTALKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEE
RKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPAR
FKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINL
AAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLK
PHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS
NT seq 4617 nt   +upstreamnt  +downstreamnt
atggagcctcgcatggagtcctgcctggcgcaggtgttgcagaaggatgtggggaaacga
ttgcaggttggccaagaactgatagactatttctcagacaaacagaagtctgctgacctt
gagcatgaccagaccatgttagataaacttgtggatggacttgctacctcttgggtgaac
tctagcaattacaaggtggttctgctgggcatggacatcctgtccgccctggtgacccgg
ctgcaggatcggttcaaggcgcagatcggcacagtgctgccaagtctaatagacagacta
ggagatgctaaagactctgtgagggagcaggaccaaactctgctgctaaagatcatggat
caagctgctaatccccagtacgtatgggacagaatgcttggaggcttcaaacacaagaat
ttccgtactcgagaaggcatctgtctctgccttatagcaacactcaatgcctctggagca
cagactttaacactaagcaagattgtgccacatatatgcaacttacttggagatccaaac
agccaggttcgagatgcagcaataaacagcttagtggaaatttacagacatgtaggagaa
cgtgtgagggcagatctcagtaaaaaaggattgccacagtcccggttgaatgtaattttt
acaaaatttgatgaagtccagaaatctggaaacatgatacaatctgcaaatgataaaaat
ttcgacgatgaagattctgtggatggtaacagaccttcctctgctagttctacatcatcc
aaggctccaccaagttctcggagaaacgttggaatgggaaccacccgccggcttggttca
tccacccttggatccaagtcttcagctgcaaaagaaggagctggtgctgttgatgaagag
gattttattaaagcatttgatgatgtacctgtagtacagatttattccagccgagacctt
gaggaatccataaacaaaattagggaaatattatctgatgacaagcatgattgggagcag
agagtaaatgctctaaaaaagattagatctttacttttggctggtgctgctgagtatgat
aacttctttcaacatttgcgtcttttggatggagcctttaaactctctgctaaggacctg
cggtctcaggtagtgcgggaggcttgtatcacgttggggcatctgtcatcagttctgggg
aataagtttgaccatggagctgaagccattatgccaactatctttaatttaattccaaac
agtgccaaaattatggccacatctggtgttgtagctgttaggttaattattcggcacaca
cacatccctaggttaatacctgtcataacaagcaactgtacctctaagtctgtcgcagtt
agaaggcgctgttttgaatttttagatttgcttttacaagaatggcagacacattcacta
gaacgacacatatcagtattagctgaaacaataaagaagggaatacatgatgctgattcc
gaagcaagaatagaagccagaaaatgttactggggtttccacagtcacttcagcagagaa
gcagagcacttgtaccacaccttggagtcctcctaccagaaagccctgcagtcccacctg
aagaactcagacagcatagtgtctctgcctcagtcagaccgctcatcttccagctctcaa
gagagtctaaatcgtccgctgtctgccaaaagaagtcctactggaagtaccacatctaga
gcttctacagttagtaccaaatctgtgtcaacgactgggtccctccagcgatctcgaagt
gatattgatgtgaacgcagcagccagtgccaaatccaaagtctcctcatcttcgggcacg
acgcctttcagctctgcagcagctttgcctccagggtcatacgcatccttaggtcggatc
cgcacaagacggcaaagctctgggagtgccaccaacgtcgcctctacacctgataaccgg
ggccgcagtcgcgctaaagtggtttcacagtcccagcgatccagatctgctaatcctgct
ggtgctggcagccggtcaagttccccaggaaaattgttgggaagtggttatggtggactt
actgggggctcctcacgaggcccacctgtgacaccgtcttcagaaaagcgaagcaagatt
cccaggagccagggatgtagccgggaaacaagtccaaaccgaataggattagcacggagc
agccgtatccctcgacccagcatgagtcaggggtgcagccgcgataccagccgtgagagc
agccgagatacaagccctgctcggggctttcctccacttgatcggtttgggcttggccag
ccaggaagaatacctggttctgtgaatgccatgagagttctgagcacaagtacagatctt
gaagctgctgttgctgatgctttgaagaagcctgtgaggaggagatatgagccgtatggg
atgtattctgacgatgatgccaacagtgatgcctcaagtgtttgctctgagcgctcatat
ggctccaggaatggtggcattccccattatctgcggcagactgaggatgtagcagaagtt
ctcaaccactgtgctagttcaaactggtcagaaaggaaagaagggcttctgggcctgcag
aacttactgaagagccaaagaacactgagtcgagttgaactgaaaaggttgtgtgagatc
ttcactcggatgtttgctgaccctcatagcaagagagttttcagtatgtttttggagact
cttgtggattttataataattcataaggatgatttacaagactggctttttgttcttctc
acacaattacttaagaaaatgggagcagatttacttggatctgtgcaagcaaaagttcaa
aaggctctagatgtcacaagggactcctttccatttgatcaacaatttaacattttgatg
agatttattgtggatcaaactcaaactccaaacctcaaggtcaaagttgcaatcctgaaa
tacattgagtctctggccagacagatggatccaacagattttgtaaactctagtgagaca
aggcttgctgtttctagaatcataacctggacaacagaaccaaagagttcagacgtgaga
aaggcagcacagattgtgctaatctctctgtttgaattgaatactcctgaatttaccatg
ttacttggtgccttgccaaaaacattccaggatggtgccaccaaactcctgcacaaccac
ctcaagaattccagtaacaccagtgtgggctctccaagcaatacgattggccggacgccc
tcccgacacaccagcagcaggaccagccccctgacctcacccaccaactgttcccatggg
ggtctgtctccaagtcggttatggggttggagtgccgacgggttagcgaagcacccacct
cccttttctcagcctaactccatccccaccgctccctcccacaaggctctcaggcgctct
tactctcccagcatgctggactatgatacagagaacctgaactctgaagaaatctatagt
tctctacgtggagttacagaagccattgaaaagtttagttttcgaagccaagaagatctg
aatgagccaattaaacgagatggcaaaaaggagtgtgatattgtgtcccgcgatgggggc
gctgcctcccctgccactgagggccgggggggtagtgaagtagaaggaggccggacagct
ctggataacaagacctcactactcaacacccagcctccgcgcgccttcccggggccgcgg
gcgcgagactacaacccgtacccctactcagatgccatcaacacctacgacaagaccgcc
ctgaaagaggctgtgttcgatgacgacatggagcagcttcgagacgtgcccatcgaccat
tctgacctggtggctgaccttctgaaagagctgtccaaccacaatgagcgagtggaggaa
cggaagggagccctgctggagctgctcaagatcacgcgggaagacagccttggtgtctgg
gaggagcacttcaagaccattctgctcctgctgctggagacccttggagacaaagaccat
tcaattcgagcactggcgttaagagttttgagggaaattctgagaaatcaaccagcaaga
tttaaaaactacgccgagctgacgattatgaagactctggaagcccacaaagactcccat
aaggaggtggtgagagcggctgaggaggctgcgtccacactggccagttccatccacccg
gagcagtgcatcaaggtgctctgccccatcatccagacggccgactaccccatcaacctt
gctgccatcaagatgcagaccaaagtcgtcgagaggatcgcaaaggagtcattgctgcag
ctccttgtcgacatcatcccaggcttgctgcagggttatgacaacaccgaaagtagtgtg
cgtaaggccagcgtgttttgcttagtggcaatttattccgtaatcggagaagacctgaaa
cctcaccttgcacagctcacagggagcaagatgaagctactaaacttatacataaagagg
gcccagaccaccaacagcaacagcagctcctcctccgatgtctccacgcacagctaa

DBGET integrated database retrieval system