KEGG   Homo sapiens (human): 23339Help
Entry
23339             CDS       T01001                                 

Gene name
VPS39, TLP, VAM6, hVam6p
Definition
(RefSeq) VPS39 subunit of HOPS complex
  KO
K20183  Vam6/Vps39-like protein vacuolar protein sorting-associated protein 39
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    23339 (VPS39)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23339 (VPS39)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    23339 (VPS39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps39_2 Vps39_1 CNH Clathrin Hira
Motif
Other DBs
NCBI-GeneID: 23339
NCBI-ProteinID: NP_001288067
OMIM: 612188
HGNC: 20593
Ensembl: ENSG00000166887
Vega: OTTHUMG00000130467
Pharos: Q96JC1(Tbio)
UniProt: Q96JC1
Position
15q15.1
AA seq 886 aa AA seqDB search
MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCN
RFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLF
TCDLQHTETGEEVLRMCVAVKKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVG
FKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCA
LNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASN
HFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQK
RFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYL
TQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLL
RLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTV
QYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLA
IPYLEHIIHVWEETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEY
RQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAE
EYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQAALQVLELHHS
KLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQ
QVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgctttcgagccagtgccgatcctagaaaagctgcctctgcaaatcgactgt
ctggctgcctgggaggaatggcttcttgtgggaaccaaacaaggacatcttcttctctat
aggattcggaaggacgttgtgccagcagatgtagcatcacctgaaagcggcagttgcaac
agatttgaagtgacactagagaaatccaataagaacttctccaaaaagattcagcagatc
catgtggtttcccagtttaagattctggtcagcttgttagaaaataacatttatgtccat
gacctattgacatttcaacaaatcactacggtttcaaaggcaaagggagcatcactgttt
acttgtgacctccagcacacagagaccggtgaggaggtgttacggatgtgtgtggcagta
aaaaagaagctgcagctctatttctggaaggacagggaatttcatgaattgcagggggac
tttagtgtgccagatgtgcccaagtccatggcgtggtgtgaaaattctatctgtgtgggt
ttcaagagagactactacctaataagggtggatggaaaggggtccatcaaagagctcttt
ccaacaggaaaacagctggagcccttagttgcacctctggcagatggaaaagtggctgtg
ggccaggatgatctcaccgtggtactcaatgaggaagggatctgcacacagaaatgtgcc
ctgaactggacggacataccagtggccatggagcaccagcctccctacatcattgcagtg
ttgcctcgatatgttgagatccgaacatttgaaccgaggcttctggtccaaagcattgaa
ttgcaaaggccccgtttcattacctcaggaggatcaaacattatctatgtggccagcaat
cattttgtttggagactcatccctgtccccatggcaacccaaatccaacaacttctccag
gacaagcagtttgaattggctctgcagctcgcagaaatgaaagatgattctgacagtgaa
aagcagcaacaaattcatcacatcaagaacttgtatgccttcaacctcttctgccagaag
cgttttgatgagtccatgcaggtctttgctaaacttggcacagatcccacccatgtgatg
ggcctgtaccctgacctgctgcccacagactacagaaagcagttgcagtatcccaaccca
ttgcctgtgctctccggggctgaattggagaaggctcacttagctctgattgactacctg
acacagaaacgaagtcaattggtaaagaagctgaatgactctgatcaccagtcaagcacc
tcaccgctcatggaaggcactcccaccatcaaatccaagaagaagctgctacaaatcatc
gacaccaccctgctcaagtgctatctccatacaaatgtggccctggtggcccccttgcta
cgcctggagaacaatcactgccacatcgaggagagcgagcacgtgctaaagaaggctcac
aagtacagtgagcttatcatcctgtatgagaagaaggggctccacgagaaagctctgcag
gtgctcgtggaccagtccaagaaagccaactcccctctgaaaggccacgagaggacagtg
cagtatctgcagcatctgggcacagaaaacctgcatttgattttctcctactcagtgtgg
gtgctgagagacttcccagaagatggcctgaagatatttactgaagatctcccggaagtg
gagtctctgccacgtgatcgagtcctcggcttcttaatagagaattttaagggtctggct
attccttatctggaacacatcatccatgtttgggaggagacaggctctcggttccacaac
tgcctgatccagctatactgtgagaaggtgcaaggtctgatgaaggagtatctcctgtcc
ttccctgcaggcaaaaccccagtcccagctggagaggaagagggtgagctgggagaatac
cggcaaaagctcctcatgttcttggagatttccagctactatgatccaggccggctcatc
tgtgattttccctttgatggcctcttagaagaacgagctctcctgttggggcgcatgggg
aaacatgaacaagctcttttcatttatgtccacatcttgaaggatacaaggatggctgag
gagtactgccacaaacactatgaccgaaacaaagatggcaacaaagatgtgtatctgtcc
ctgcttcggatgtacctgtcgccccccagcattcactgcctggggccaatcaagctggaa
ctactggagccaaaagccaacctccaggccgctctgcaggtcctcgagctacaccacagc
aaactggacaccaccaaggccctcaaccttctgccagcaaacactcagatcaatgacata
cgcatcttcctggaaaaggtcttggaagaaaatgcacaaaagaaacggttcaatcaagtg
ctcaagaaccttctccatgcagaattcctgagggtccaggaagagcggattttacaccag
caggtgaagtgcatcatcacagaggagaaggtgtgcatggtgtgtaagaagaagattggg
aacagtgcatttgcaagataccccaatggagtggtcgtccattacttctgttccaaagag
gtaaacccagctgacacttga

DBGET integrated database retrieval system