KEGG   Homo sapiens (human): 23345
Entry
23345             CDS       T01001                                 

Gene name
SYNE1, 8B, AMCM, ARCA1, C6orf98, CPG2, EDMD4, KASH1, MYNE1, Nesp1, SCAR8, dJ45H2.2
Definition
(RefSeq) spectrin repeat containing nuclear envelope protein 1
  KO
K19326  nesprin-1
Organism
hsa  Homo sapiens (human)
Disease
H00563  Emery-Dreifuss muscular dystrophy
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23345 (SYNE1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    23345 (SYNE1)
SSDB
Motif
Pfam: Spectrin CH KASH CAMSAP_CH
Other DBs
NCBI-GeneID: 23345
NCBI-ProteinID: NP_892006
OMIM: 608441
HGNC: 17089
Ensembl: ENSG00000131018
Vega: OTTHUMG00000015841
Pharos: Q8NF91(Tbio)
UniProt: Q8NF91
Structure
PDB: 
4DXR

Position
6q25.2
AA seq 8797 aa
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLE
DAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP
GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEM
KRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYR
AEVALREEITVQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPD
QLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLL
QNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVE
VRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAM
NDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVTL
SAFATEAHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQE
EGKEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITV
LEREAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQ
IADIHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELL
RRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLL
HLKIDVEKNRFLASVEECRTELDRETKLMPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQL
IEELCVKLPVRDPVRDTPGTCHVTLKELRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWI
STNETQLKGIKGEAIDTANHGEVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENEA
QKQGDELAKLSSSFKALVTLLSEVEKMLSNFGDCVQYKEIVKNSLEELISGSKEVQEQAE
KILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQGEGGLPDRGHEELRKLEST
LDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELE
QTKEFSKRTESIAVQAENLVKEASEIPLGPQNKQLLQQQAKSIKEQVKKLEDTLEEDIKT
MEMVKTKWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEIESKLSSI
VGLEEEAQSFAQFVTTGESARIKAKLTQIRRYGEELREHAQCLEGTILGHLSQQQKFEEN
LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVV
NRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTWLERGEAKASS
PEMDISADRVKVEGELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKDDVKMMKLHLE
QLDERWRDLPQIINKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDHQ
VALTRHKDHAAEVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVV
ERRQLALSHLAEFLQSHASLSGILRQLRQTVEATNSMNKNESDLIEKDLNDALQNAKALE
SAAVSLDGILSKAQYHLKIGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEADALAVLK
KAFQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKD
KAKQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSK
VLENASSVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLLSELKKIH
SSDFSLVKTDMESTVDKWLDVSEKLEENMDRLRVSLSIWDDVLSTRDEIEGWSNNCVPQM
AENISNLDNHLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPDLQFIEAD
LMQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDITTWFTKVEESLMNCAQNETCEALK
KVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVSQLCSKTQ
ASLQESLEKHFSESMQEFQEWFLGAKAAAKESSDRTGDSKVLEAKLHDLQNILDSVSDGQ
SKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSF
EDQHRKLNLWIHEMEERFNTENLGESKQHIPEKKNEVHKVEMFLGELLAARESLDKLSQR
GQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWFWV
KAIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQ
RVIQTQLETLKEVWADIMSSSVHAQSTLESVISQWNDYVERKNQLEQWMESVDQKIEHPL
QPQPGLKEKFVLLDHLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTAQEELKTQ
FNDIMTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKL
SKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQT
QSCLENLVSQMALSEQEFSGQVAQLEQALEQFSALLKTWAQQLTLLEGKNTDEEIVECWH
KGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQN
KEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENGQHK
LNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALENLKIQMKDFEV
SAEPIQDWLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQL
WEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAI
HMLDSYCHPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQ
QQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDGVRQFSGWMDSMEANLNESERQHA
ELRDKTTMLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERA
KEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQV
HCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTQFNNVVNKL
RLMEQKFQQVDEWLKTAEEKVSPRTRRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGA
RAQEILDESHVNSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESSLSSYSDW
YGSTHKNFKNVATKIDKVDTVMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEE
GEAERLRKEIHDHMEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILH
VPEEPKMELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQ
SDYQDLCSIGKEHVFSLEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETIT
QQLAHHKAMMEEIAGFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAI
CSTAQRMYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLEPSPQPPLSRAEAIKQVKHFR
ALQEQARTYLDLLCSMCDLSNASVKTTAKDIQQTEQTIEQKLVQAQNLTQGWEEIKHLKS
ELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTIIEKVNKLT
KKEESPEHKEINHLNDQWLDLCRQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEW
DNLARSDAESTAVHLEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSH
LEQRWFQLEDLIKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPNIAEALKQSPPPDMA
QNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDL
VGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQ
ASLKTYQNEVTGLWAQGRELMKEVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKN
LVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESSELHTQLAKYQNILEQSPEYENLLL
TLQRTGQTILPSLNEVDHSYLSEKLNALPRQFNVIVALAKDKFYKVQEAILARKEYASLI
ELTTQSLSELEAQFLRMSKVPTDLAVEEALSLQDGCRAILDEVAGLGEAVDELNQKKEGF
RSTGQPWQPDKMLHLVTLYHRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQLKSVKEE
QSKVNEETLPAEEKLKMYHSLAGSLQDSGIVLKRVTIHLEDLAPHLDPLAYEKARHQIQS
WQGELKLLTSAIGETVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDI
QEEIRKIQIHQEEVQSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEA
LRTRQATLTEIYSQCQRYYQVFQAANDWLEDAQELLQLAGNGLDVESAEENLKSHMEFFS
TEDQFHSNLEELHSLVATLDPLIKPTGKEDLEQKVASLELRSQRMSRDSGAQVDLLQRCT
AQWHDYQKAREEVIELMNDTEKKLSEFSLLKTSSSHEAEEKLSEHKALVSVVNSFHEKIV
ALEEKASQLEKTGNDASKATLSRSMTTVWQRWTRLRAVAQDQEKILEDAVDEWTGFNNKV
KKATEMIDQLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQQTLSMLQ
DGAAPTPGEEPPLMQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQ
ETKEYLGNPTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKEKYLGLYTILPSELSLQL
AEVALDLKIRDQIQDKIKEVEQSKATSQELSRQIQKLAKDLTTILTKLKAKTDNVVQAKT
DQKVLGEELDGCNSKLMELDAAVQKFLEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLS
KLNQAASHLEEYNEMLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEID
SELEAMTEKLQYLTSVYCTEKMSQQVAELGRETEELRQMIKIRLQNLQDAAKDMKKFEAE
LKKLQAALEQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPE
DVVASLPLCHAALRLQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQLIEGAHRE
IEDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTE
VEGLAEGTEDLDGELLPTPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACR
SPSPVANTDASVNQDIAYYQALSAERLQTDAAKIHPSTSASQEFYEPGLEPSATAKLGDL
QRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQM
AEHQALMDEILMLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIRMK
ASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDTALSPPKEPMDME
AQLMDCQNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLELQ
RALHDKQLNMQGTAQEKEESDVDLTATQSPGVQEWLAQARTTWTQQRQSSLQQQKELEQE
LAEQKSLLRSVASRGEEILIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRMKWE
SLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDGLNQ
AFEEVSSQSGGAKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQE
ILAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMK
ERLQQILNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKEFDAGI
IELKRRGDKLQVEQPSMQELSKLQDMYDELMMIIGSRRSGLNQNLTLKSQYERALQDLAD
LLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKET
QFHTELMAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVESSIPSVGLVEE
NEDRLIDRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGECWLSNT
NKMSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLN
AFLEFSKEVDAQSSLKSSVLSTGNQLLRLKKVDTATLRSELSRIDSQWTDLLTNIPAVQE
KLHQLQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDI
NCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGL
LESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEK
IEQNGLALIQNKKEDVSSIVMSTLRELGQTWANLDHMVGQLKILLKSVLDQWSSHKVAFD
KINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQERSLQKFGSITNQLLKE
CHPPVTETLTNTLKEVNMRWNNLLEEIAEQLQSSKALLQLWQRYKDYSKQCASTVQQQED
RTNELLKAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFFLHELGEQLKQQVDASAAS
AIQSDQLSLSQHLCALEQALCKQQTSLQAGVLDYETFAKSLEALEAWIVEAEEILQGQDP
SHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLI
SSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELF
QAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDS
QIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEVQFKEKVFLRQQGS
YILTVEAGKQLLLSADSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEK
GIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSA
YISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNKELCEWLTQME
SKVSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLG
KVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSE
EIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRW
RNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELK
KFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSIL
RRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNH
NKIEQIIAQGEQLIEKSEPLDAAIIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEH
DLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSERSGRDTPASVDS
IPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGK
ALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEES
LPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTE
EELEQLQRLELSTDIQTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESRDL
QDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVPID
SNLDAEILQDHHKQLMQIKHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGN
RLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPR
GKCSLSQPGPSVSSPHSRSTKGGSDSSLSEPGPGRSGRGFLFRVLRAALPLQLLLLLLIG
LACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
NT seq 26394 nt   +upstreamnt  +downstreamnt
atggcaacctccagaggggcctcccggtgtcctcgggatatcgccaatgtgatgcagagg
ctgcaagatgagcaagagatagtacaaaaacgaactttcacaaaatggatcaactctcat
ctggccaagcggaaacctccaatggtggtggacgatctttttgaagacatgaaagatggt
gttaaactgcttgcccttctggaggtcctgtctgggcagaaactgccttgtgaacaagga
cgccggatgaagcgaatccatgctgtggctaacattggcacggcactcaagttcctcgaa
ggaagaaagattaaattagtcaacattaactccaccgatatagctgatggccgaccctca
atagttcttggattgatgtggaccattattctatatttccagattgaagagttgaccagc
aacctgccccagctccagtctttgtccagcagcgcatcctccgtggacagcatagttagc
tctgagactcccagcccaccaagtaaacggaaggtgaccaccaagatccaaggaaatgct
aagaaggctttattaaagtgggttcagtacacagctggcaagcagactggaatagaagta
aaagattttgggaagagttggagaagcggggttgcctttcattcagttattcatgccatt
cgaccggaattggtggacttggagacagtgaaaggcagatccaaccgagaaaatttggag
gatgctttcactatcgccgaaacagaactggggatcccaagactgctagatcctgaagac
gttgatgtggataaaccagatgagaaatctattatgacctatgtagcccagtttctgaaa
cattatcctgacatccacaatgcaagcactgatgggcaagaggatgatgaaatacttcca
ggtttcccatcttttgcaaattctgtacaaaattttaagagagaagacagagtaattttt
aaggaaatgaaagtttggatagaacaatttgagagagatttgacaagagcacagatggtg
gaatcaaatttacaggataaatatcagtcatttaagcacttcagagttcaatatgaaatg
aagaggaaacagattgaacatttaatacaaccattacacagagacggtaaattgtcactt
gaccaagcattggtaaaacaatcttgggatagagtgacctccaggctctttgactggcat
atacagcttgataaatctcttcctgcacctctgggcaccataggtgcctggctgtacaga
gcggaggtggccctgagagaggaaataaccgttcaacaggtccacgaggaaacagcaaac
acgatacaacggaaacttgagcaacataaggatctgcttcaaaacacggatgcccacaaa
agagcattccatgaaatctaccggaccaggtctgttaacgggattccagtgccacctgat
caattagaggacatggccgagaggtttcattttgtttcctccacatcagagctacaccta
atgaaaatggaatttttagaattaaagtaccgtctgctctcactgctggttcttgcagag
tcaaagctgaagtcttggatcattaagtacgggaggagagagtcagtggagcagcttcta
caaaactacgtgtcttttatagaaaatagcaagttctttgaacaatatgaggtgacatac
cagatcttgaaacagacagctgagatgtatgtcaaagcagatggttcagtggaagaagct
gagaatgtgatgaaattcatgaatgaaaccaccgctcagtggaggaatctctcagtagaa
gtgaggagtgtgaggagcatgctggaagaagtgatctctaactgggatcgctatggcaat
acagtggctagtctgcaagcctggctagaggatgctgaaaaaatgctcaatcaatcagaa
aatgccaaaaaggatttttttcgaaatttacctcattggattcagcagcatactgccatg
aacgatgctggcaattttctaattgaaacctgtgatgagatggtttcccgtgacctgaag
cagcaattactgttgctaaatgggcggtggagggagttgtttatggaagtcaagcaatat
gctcaagctgatgagatggacagaatgaagaaggaatacacagactgtgttgttaccctg
tctgcttttgcaacggaagcccataagaaactttctgaacccttagaagtctcttttatg
aatgtcaagctattaattcaagacttggaggatattgagcagagggtgcctgtgatggat
gcccaatacaagataattacaaagacagcacacctcattaccaaagaaagcccccaagaa
gaaggaaaagaaatgtttgcgaccatgtcaaagctcaaagagcagctaaccaaggtcaaa
gaatgttactccccactcctttatgagtctcagcagctgttgattccgttggaggaatta
gaaaagcagatgacgtccttttatgactcacttgggaaaatcaatgaaattatcacagtt
cttgagcgtgaggcacaatcgagtgccctttttaaacaaaaacatcaggaactgttagct
tgtcaagaaaactgtaagaaaaccttgacacttattgagaaaggcagtcaaagtgttcaa
aagtttgtgaccttgagcaacgtgttaaagcattttgatcagacgaggctacaaagacag
attgcagatattcatgttgcttttcagagtatggtaaagaaaactggagattggaagaag
catgtggaaaccaacagtcgcttgatgaagaagtttgaggagtctcgagcagagttggag
aaggtactgcggattgctcaggagggcctggaggaaaagggggatccagaggagctcctg
cggagacacactgagtttttcagtcagctggatcagagggtgctcaatgctttcctgaaa
gcttgtgatgaactcaccgacatccttccagagcaggagcagcaggggctgcaggaagct
gttcgaaagctccacaaacaatggaaggatcttcaaggagaagccccttatcatttgctt
catctgaagattgatgtggagaagaataggttcttagcctctgtagaagaatgcagaact
gagctggatcgagagaccaagctgatgccccaggaaggcagtgaaaagataattaaagag
cacagggttttcttcagtgacaaaggtcctcatcatctctgtgagaaaaggttacagctc
atcgaggaactctgtgtgaaactcccagtgcgggacccagtaagggacacacctggaacc
tgtcacgtgactctcaaagagctcagagctgccattgacagcacctacaggaagctcatg
gaagacccagacaagtggaaggactacactagcagattctctgagttctcatcttggata
tctacaaatgagacacaattaaaggggatcaagggtgaggccatcgatactgccaaccac
ggagaggttaaacgtgccgttgaagagatcagaaatggtgttaccaaaaggggtgagacc
ctcagctggctgaaatccaggctgaaagttttgacagaagtttcttctgagaatgaagcc
caaaagcagggagatgagctggcaaaattatccagctctttcaaggctcttgtgacgctg
ctgtcagaggttgaaaagatgctaagcaattttggggactgtgtccagtacaaagaaata
gtcaaaaattctctcgaagaattaatttctggctctaaagaagtccaggaacaagctgag
aagatcttggatactgaaaatctgtttgaagcacagcagttacttcttcatcaccagcaa
aagacaaagcggatctcagcaaagaagagagatgtgcagcagcagatcgcgcaggcgcag
cagggagaaggggggctgcctgaccgaggccacgaggagctgcggaagctggagagcaca
ctggatggcctggagcgcagccgggagaggcaggaacgccgcatccaggtcacattaaga
aaatgggagcgatttgaaacaaacaaagaaacagtagtaagatacctttttcaaacaggt
tccagtcatgaacgcttcttgagttttagcagtttggaaagtttatcttcagaactggaa
caaacaaaggagttttctaaacggacagaaagtattgcagtccaggctgagaaccttgta
aaggaagcttcagagataccgcttgggccccaaaataagcagctgcttcaacagcaggcc
aagtcaatcaaagaacaagtcaaaaaattagaagacacgcttgaagaagatattaaaacc
atggaaatggtgaaaaccaagtgggatcattttggcagtaattttgagactctgtccgtc
tggataactgagaaagaaaaagaactcaatgccttggaaacttcgtcatctgccatggac
atgcaaatcagccaaattaaggtcacaattcaggaaatagaaagtaagctcagcagcatt
gtaggattagaagaagaagcccagtcttttgctcagtttgttaccactggagaatctgct
cgaattaaagccaagttgacacaaataagaagatacggggaagagcttcgagagcatgca
cagtgtctggaaggaacaatcctgggacatttatctcagcagcaaaagtttgaagagaac
cttagaaagatccagcaatctgtgtctgaatttgaagataaacttgctgttccaattaaa
atatgttcttcagctacagaaacatacaaagttcttcaagaacatatggatctctgccag
gccctggagtcactgagcagcgcgatcactgccttctcagccagtgccaggaaggttgtg
aacagagattcctgtgttcaggaggctgcggctctacagcagcaatacgaggacatccta
aggagggcgaaggagagacagacggcgctggagaatctgctggcccactggcagaggcta
gagaaagaactatcatcctttttgacctggttagagcggggtgaagctaaagccagttcc
ccagaaatggacatttctgcagacagagtcaaagtggaaggtgaacttcagttaatacag
gcactgcaaaatgaagttgtatcccaggcctcattctatagcaaacttttgcaattgaag
gaatcattgttctcagtagcctccaaagatgatgtgaaaatgatgaaactacatttggag
cagttggatgagagatggagagatttaccacagatcattaacaaaaggattaattttctt
cagtctgtggttgctgaacaccagcaatttgatgagctgctgctttccttttctgtctgg
attaaactgtttctcagtgaattacaaactacctctgagattagcataatggaccatcaa
gtagcccttactcggcataaggaccacgcagcagaagtagagagcaaaaagggcgaattg
cagagtctgcagggtcacttagcaaagttgggttctctgggccgtgctgaggacctccac
ctcctgcagggaaaggctgaggactgcttccagctgtttgaggaggccagccaggttgtg
gagaggcggcagcttgccctgtcccatttggcagaattcctccagagccatgcctctctg
tccggcattctccgccagctgaggcaaacagtggaagcaaccaacagtatgaataagaac
gagtctgatttgatagaaaaggacctcaatgatgctcttcaaaatgctaaagcattagaa
tctgctgccgtcagtctggatggcattctttccaaagcccaataccatctgaaaatcggg
agctctgagcaaaggacttcctgcagagccacggctgatcagctctgtggagaggtagag
aggatccagaaccttctgggaaccaagcagagtgaggcagatgctctggcagtgttgaaa
aaagcattccaagaccagaaagaggagcttctgaaaagcattgaggacattgaagaaagg
actgacaaagagcgattgaaagaacctacccgccaagctcttcagcagaggttaagagtg
tttaatcagctagaagatgaattgaattctcacgagcatgaactatgttggttgaaagac
aaagccaagcaaattgcccagaaagatgtagcttttgcacctgaagttgacagggagata
aaccgcttagaggtcacctgggatgataccaaaagactaattcatgaaaatcagggtcag
tgctgtggacttattgacttaatgagagaatatcagaacctgaaatcagctgtatctaaa
gtcttagaaaatgccagcagtgtgattgtaaccagaactaccataaaagatcaggaggat
cttaaatgggctttttccaagcatgaaactgccaagaacaaaatgaattacaaacagaaa
gacttggataactttaccagcaaaggaaaacacttgttatctgagctgaagaaaattcac
agtagtgatttcagcttggtgaaaacagacatggagagcaccgtggacaaatggctggat
gtatcagagaaacttgaagaaaacatggataggctgagagtaagcctgtccatttgggat
gatgtactgtcaactagagatgagattgagggatggtcaaacaactgcgttccacagatg
gcagaaaacatcagcaacctggataaccacctcagagctgaagaactgcttaaagaattt
gagtctgaagttaaaaacaaagcattgagattggaagaactgcattccaaagttaatgat
ctgaaagaattaactaaaaatctagaaacaccgccagaccttcagtttatagaagcagac
ttaatgcagaaactggagcatgccaaagaaataactgaagtagcaaaaggaaccctgaag
gatttcacggctcaaagtacacaagtggagaagtttattaatgacataacaacatggttc
acaaaagtggaagaatcgttgatgaactgtgcccaaaatgagacttgtgaagcattgaaa
aaagtcaaggatatacaaaaagaacttcaaagtcaacaaagcaacatcagctctacccaa
gaaaatctcaatagcttgtgccgcaagtaccactcagctgagttggagagcctgggccgt
gcaatgactggtctgataaagaaacatgaagccgtgagccagttgtgctccaaaacccag
gccagcctgcaggaatctctggaaaaacacttcagtgagtctatgcaggaattccaagaa
tggtttttgggagcaaaggcagcagcaaaagaatcatcagatcgcaccggtgacagcaaa
gttctagaagcaaagctccatgatcttcagaacattttggactcagtcagtgatgggcag
agcaaacttgatgcagtgactcaagaaggacaaactttgtatgcacatttgtctaaacaa
attgtcagtagcattcaagaacaaatcacaaaggccaatgaagagtttcaagcatttctg
aaacaatgccttaaagataagcaggctcttcaagactgtgcttcagaacttggaagcttt
gaagatcagcacagaaaactgaacttatggatccatgaaatggaagaaaggttcaatacg
gaaaacttgggagagagtaaacagcacattcctgagaagaaaaatgaagttcataaagtt
gaaatgtttttgggagaactgctggctgcaagagagtctcttgataagctttcccagaga
gggcagcttctgagtgaagaaggccacggtgctgggcaggagggccgcctgtgttcccag
ctcctcacaagccaccagaacctacttagaatgaccaaagagaaactccggagctgccag
gtggcccttcaggagcacgaagccctggaggaagcactgcaaagcatgtggttctgggtg
aaggccattcaggacagactggcctgtgcagagagcactcttgggagcaaagacaccctg
gagaaacggctgtcacaaatacaggatattctcctgatgaaaggtgaaggggaagttaag
ttgaatatggccattggcaagggggaacaggccttgagaagtagcaacaaagaaggtcag
agggtgattcagactcagttagagacccttaaagaagtgtgggctgacatcatgagctcc
tccgtccacgctcaaagcactttagagtctgtgattagccaatggaatgactatgtagag
aggaaaaaccagttggagcagtggatggaatcagtggatcaaaaaatagaacatccctta
caaccacagccaggtctgaaagagaagttcgtcctgcttgaccacctccagtccatcctg
tctgaggcagaagatcacacgagagcccttcaccgtctaattgcgaagtccagggagctc
tacgaaaagacagaggatgagtctttcaaggacacagctcaagaggagctgaaaacacag
tttaatgatataatgactgttgccaaggaaaaaatgaggaaagtggaagagattgtgaaa
gatcatctaatgtatttagatgcggtccacgagttcacagattggctccattcagcaaag
gaagaacttcaccggtggtcagatatgtctggagattcatcagccacccagaaaaagtta
tcaaaaattaaggagctgatagattccagagagattggtgcaagccgtctcagcagagtg
gagtcgctggctcccgaagtgaaacagaacacaactgccagtgggtgtgagctcatgcac
acggagatgcaggccctgcgtgccgactggaagcagtgggaagacagtgtattccaaacg
cagagctgtttggagaacctggtcagccagatggccctttcggagcaggaattctcaggc
caagtggctcaactggagcaggccctggaacagttcagtgcccttctgaaaacctgggct
cagcagttaaccctcctggaaggcaagaacacggatgaggagatagtggaatgctggcac
aaaggacaagagatactggatgctttgcaaaaagcagagcctagaacagaggatctcaag
tctcagctgaatgaactttgtcgattttccagagacctgagtacctacagtggaaaagtt
tctggcttgattaaagagtataattgtctttgtttgcaagcatccaagggctgccagaat
aaagaacagattttacagcaaagatttcgaaaggccttcagggatttccagcagtggttg
gttaatgcaaaaatcactaccgccaagtgttttgatatacctcaaaatataagtgaagtt
tcaactagtcttcagaaaatacaggagtttttgtcagaaagtgaaaatggacagcacaag
ctaaacatgatgctgtctaaaggggaacttctgagtaccctgctgaccaaagagaaagcg
aaagggatccaggccaaagttacagctgcaaaagaagattggaaaaattttcattcaaat
ctccaccaaaaagaatctgctctagagaatctaaagatccaaatgaaggactttgaagta
agtgctgagcctatccaggactggctgagtaaaactgagaagatggtccatgaaagcagc
aatcgcctctatgatctgccagcaaagaggagggagcagcagaagctccagtctgtcctt
gaggaaatacactgctacgagcctcagctcaacaggctgaaagagaaagctcagcagctg
tgggaaggacaagctgccagcaagagctttaggcacagagtgtcgcagctgtcttctcag
tatctagcgctaagcaatttaacaaaggagaaagtgtcaagactggatagaatcgttgca
gaacacaatcagttctctcttgggattaaagaattacaagactggatgacggatgcgatt
cacatgctggattcatactgccacccgacatccgacaaaagtgtgctggacagcaggacg
ctcaagctcgaggctctattatcagtcaaacaggaaaaagagattcagatgaaaatgata
gtgaccaggggagaatctgtccttcagaatacttctccagaaggcattcccactattcag
cagcagctgcagagtgtgaaggatatgtgggcatcccttttgtctgcagggattcgttgt
aaaagccaactcgaaggagctctctccaagtggacaagttatcaggatggcgttcgacag
ttctccggttggatggatagtatggaagccaacctgaatgaatcagaaaggcagcatgcg
gagctgcgggataaaacaacgatgctcggaaaagccaagttattaaatgaagaagtgctg
agttacagcagcttgctggagaccatcgaagtcaaaggggctggcatgacagaacactat
gtcacccagctagaactccaggatctacaggaacgatacagagccatccaagagagggcc
aaggaagccgtaaccaagtctgaaaaacttgtccgcctgcaccaagagtatcagagagac
ctaaaggcatttgaagtttggttggggcaagaacaagaaaagctcgaccagtattcagtt
cttgaaggtgatgcccacactcatgagacaacattgcgtgatcttcaggagctacaggta
cactgtgcagaggggcaggccctgttgaactcagtgctgcacaccagagaggatgtgatc
ccatcaggtatcccacaggcagaggaccgggctttagagtctctccggcaagactggcag
gcttaccagcacaggctgtccgagactcgaactcagttcaataacgtggtgaacaaattg
aggctaatggagcaaaagtttcagcaagtagatgaatggctcaaaacagcagaggagaaa
gttagtcccaggaccagacgtcagtctaacagggcaaccaaggagatacaattacatcag
atgaagaagtggcacgaagaagtgactgcatacagagatgaagttgaggaagtgggagct
agagctcaggagatactggacgagagccacgtgaacagcagaatgggttgccaggccacc
cagctgacttccagataccaggccctgcttctccaagtgctggaacaaataaaattcctg
gaggaggagattcagagtttggaggaatcagaatcatccctcagttcctattctgattgg
tatggctctactcataaaaacttcaagaatgtggctaccaagattgacaaagtagataca
gtaatgatggggaagaaattgaagacgttggaggttttgctcaaagacatggagaaaggt
cacagtttgctgaaatcagcccgggagaaaggagagagggctgttaaatacttggaggaa
ggcgaggcagagaggttaagaaaggagattcatgatcacatggagcagttgaaggaactg
accagcactgtccggaaagaacacatgacgctggaaaaaggtcttcatttagcaaaggaa
ttctcagataaatgcaaagcactgacacagtggatagcagaataccaggaaattctacat
gttcctgaagaacccaaaatggaattatatgagaaaaaagctcagttatctaaatacaag
tcacttcaacaaacggtgctgtcccatgaaccatcagtaaagtcagtgagagagaagggt
gaagctcttttggaactggtgcaggacgtcactttaaaggacaaaatagatcaacttcaa
agtgattaccaggacctgtgcagcataggaaaggagcatgtcttcagtctggaggcgaaa
gtcaaagaccatgaagactacaacagtgagctccaagaggtcgaaaagtggctgctgcag
atgtctggcagactggtggcacctgacctcctggagacaagcagcctggagacaatcacc
cagcaattggcccaccacaaggcaatgatggaagaaattgctggttttgaagaccgtttg
aacaatcttcaaatgaaaggtgatactttgattggccaatgtgcagaccacctgcaagcg
aaacttaaacaaaacgtgcatgctcatctgcagggcacaaaggacagctactcagcgatc
tgcagcacagctcagaggatgtaccagagtttggaacacgaacttcagaagcacgtcagc
cgacaagacaccctgcagcagtgccaggcctggctttctgcagtccagccggatttagag
ccaagtcctcaaccacctcttagtagggcagaagccattaagcaggtcaaacacttcaga
gctttgcaagagcaggcaaggacctacctagatctcctttgctccatgtgtgacctgtca
aatgcttcggtgaaaaccacagcaaaagacattcaacaaacagagcaaacgattgaacaa
aagcttgtccaggcccagaacttaactcagggctgggaagagatcaagcacctgaagtct
gagctctggatttacctgcaagatgctgatcagcaactgcagaacatgaagaggaggcac
tctgagctggagctgaacattgcacagaacatggtttcacaagttaaggattttgttaag
aaactacagagcaaacaggcatccgtgaacaccataatagaaaaggtgaataagttaaca
aagaaggaggaatcgcctgaacacaaggaaataaatcatttaaatgatcagtggctcgat
ttgtgccgtcagtctaacaacctgtgcttgcaaagggaagaggatcttcagagaacaaga
gattaccatgactgtatgaatgttgttgaagtgttcctagaaaaatttactacagaatgg
gataacttggccagatctgatgcagagagtacagctgtccacctggaagctttgaaaaag
ttagcattggcattgcaggagagaaagtatgctattgaagatctgaaagatcaaaagcag
aaaatgatagagcatctgaatttagatgacaaggagttagtcaaagaacagacgagtcat
ttagagcaacgttggtttcagcttgaggacctcattaaaaggaaaatccaagtgtcagtc
accaacttggaggagttaaatgtggtgcagtccagatttcaggagctaatggagtgggca
gaagagcaacaacccaacatcgccgaggcccttaagcagagccctcctccagatatggct
cagaaccttctcatggatcacctggccatctgcagtgaactggaggccaagcagatgctc
ctgaaatcgcttataaaggacgcagacagggtcatggcagatcttggtctcaatgagcga
caggtcatccagaaggctctctctgatgcacaaagccacgtgaattgtctcagtgactta
gtgggccagcgaagaaagtacttaaacaaagccttgtccgagaaaacccagtttctcatg
gcagtgttccaggccaccagccaaattcagcaacatgagcgaaagataatgttccgtgaa
cacatctgtctgttaccagatgatgtgagcaaacaagtcaaaacatgtaagagtgcacaa
gccagcctcaagacttaccaaaatgaagtcactggactttgggcccagggtcgcgaacta
atgaaggaagtcacagagcaggaaaagagtgaagtgctggggaagcttcaggaattgcag
agtgtctatgacagtgttttacaaaagtgcagtcaccggttacaagaactagagaagaat
ttggtttctaggaagcattttaaggaagattttgataaagcttgccactggctaaaacaa
gcagatattgttacatttcctgaaatcaacctaatgaatgagagttctgagcttcataca
caactggctaaataccaaaacattcttgaacaatctccagaatatgaaaatcttctactt
acgctgcagagaactgggcagaccatattaccatcgctgaatgaagtcgatcattcctac
ctcagtgaaaagctaaatgctttgcctcgacaatttaatgtaattgttgccttggctaaa
gacaagttctataaagtccaggaagcaattcttgctcggaaggaatatgcttccttgatt
gagttgacaacccagtctctgagtgaacttgaagcccaattcttgaggatgagcaaagtt
cccaccgacctggccgttgaggaggctctttctctgcaagatggttgcagagccattctg
gacgaggtggcgggccttggggaggcggtggatgaactgaaccagaaaaaagaaggtttt
cgcagcacaggtcagccttggcagccagacaagatgctgcaccttgtcaccttatatcac
aggctgaagcgacaaacagaacagagggttagcttattagaagacaccaccagtgcttac
caagaacacgagaagatgtgccaacagctggagagacaactgaagtctgtaaaagaggag
cagtccaaagtgaatgaggaaacgctgcctgcagaggagaagctcaaaatgtatcactcc
ctggcaggaagtctccaggactcagggattgtactgaaacgagtaaccatacatcttgaa
gatcttgccccacaccttgaccccttggcttatgagaaagccaggcatcagatccagtcc
tggcaaggggagttaaaactgttgacttctgccattggtgagacggtgacagaatgtgag
agccgaatggtgcagagtatagacttccagactgagatgagtcgctccctggactggctg
aggagagtgaaggcagagctcagtgggccggtgtacctagacctcaacctgcaggacatc
caagaggaaatcagaaaaatccaaattcatcaggaagaggtccagtccagcttgagaatc
atgaatgcgctgagtcacaaggaaaaggagaagttcacaaaggccaaggagctgatttct
gcggatttagaacacagcctcgctgagctctcagagctggatggagacatccaggaagcc
ttacgcaccagacaggctaccttgactgaaatatatagccagtgtcaaaggtattatcag
gtatttcaagcagccaatgactggcttgaggatgcccaagaattgttacagctggcaggc
aatggcctagacgtggagagcgcagaggaaaatctcaaaagccacatggaatttttcagt
acagaggatcagttccatagtaacctggaggagctccacagcctggtagccaccctggac
ccactcatcaagccaaccggcaaagaagacctagaacagaaagtggcttctctggaactc
aggagccagaggatgagccgggactctggtgcccaagtggatctcttgcagagatgcaca
gctcaatggcacgattaccagaaagcaagggaagaggttattgaattgatgaatgataca
gaaaagaaattgtctgagttttctttgttgaagacttcgtctagtcatgaagcggaagaa
aaattgtcagaacacaaggctttagtgtcagtggttaactctttccatgagaaaattgtg
gcccttgaggaaaaagcttcacaactggagaaaaccggaaatgatgccagcaaagccacc
ctgagcaggtcaatgaccaccgtctggcagcgctggacacgccttcgagctgtggcccag
gaccaggagaagatcctggaagatgcagtggatgagtggacgggctttaacaacaaggtt
aaaaaggccactgaaatgattgatcagctgcaagataagttacctggaagttcagcagag
aaagcatcgaaagcagagctcttaactcttcttgaataccacgacacgttcgttctggag
ctggagcagcagcagtcggccttgggcatgctgcggcagcaaaccctgagcatgctccag
gatggagccgccccaacccctggggaagagcctccgctcatgcaggaaatcaccgccatg
caagatcggtgcctgaacatgcaggagaaagtgaagactaatggaaagttggtgaagcaa
gagctgaaggaccgagaaatggtggagactcagatcaattctgtgaaatgttgggttcag
gaaacgaaagaatatttagggaatccaacaatagaaatagatgctcaacttgaagaactt
cagattctcctaacagaagccacaaatcaccgacagaacattgaaaaaatggcagaagaa
cagaaggagaagtacttaggtctttataccatattaccttctgaactctcccttcagttg
gctgaagtggcgttagatctaaagatccgagatcagatccaagacaaaataaaagaagtt
gagcagagcaaggccacgagccaggaactcagccggcaaattcagaagttagctaaagac
ctcacaactattctaactaagctgaaagcgaagacagataatgtagttcaagctaaaact
gaccaaaaggtgctgggagaggaattagatggctgtaattcaaagttaatggaattagat
gcagcagtacagaaattcttggaacagaatggccaactgggtaagccactggccaagaag
ataggaaaactgactgaacttcaccagcagaccattagacaagctgagaatcggctctcc
aagctcaatcaggcagcatcacatttagaagaatacaatgaaatgcttgaattaattttg
aagtggattgaaaaagctaaagtcttggctcatggaactattgcatggaattctgcaagc
cagcttcgggaacaatatattttgcatcagaccctgctagaagaatccaaagaaattgac
agtgagctggaagcaatgactgagaaattacagtacctcactagcgtgtactgtacagaa
aaaatgtctcagcaagtggcagaactgggacgggagactgaggagttgcgacagatgatc
aaaattcgtttgcagaacctccaagatgcagctaaggatatgaaaaaatttgaagcagag
ttgaaaaagttacaagctgccttggagcaagcccaggcaacactgacttctccagaagtt
ggacgtctcagtctcaaggagcagctctctcatcggcagcatttgttgtctgagatggag
tcactgaagccgaaggtgcaagcagtgcagctctgccagagtgccctccggatccccgag
gatgtggttgccagcttacctctctgtcatgctgctctgcggctgcaggaagaggccagc
cggctgcagcacaccgccatccagcagtgtaacatcatgcaggaagctgtggtacaatat
gaacaatatgagcaagaaatgaaacatctccagcaactgatagaaggagctcacagagag
attgaggataaacctgttgccaccagtaacatacaggagctgcaggctcagatttctcgg
catgaggagctggcgcagaaaattaagggctaccaggagcagatcgcttctttgaattcc
aagtgcaagatgctgacgatgaaagccaagcacgccaccatgctgctgacggtgaccgag
gtcgaggggctggcggaagggacagaggacctggatggggagctcctccccacgccttcg
gcccacccctctgtggtcatgatgactgcaggtcgctgtcacactttgctgtcaccggtc
actgaggagtctggggaggagggaaccaacagtgagatttcctctccacctgcctgtcgc
tccccttcacctgtggctaatacagatgcttctgttaaccaggacattgcatattaccaa
gccttgtctgctgagaggttgcagacagatgctgcaaaaattcaccccagcacatccgca
tcccaggagttctatgaaccgggattggagccatccgctactgccaaactgggtgatttg
cagcgttcttgggaaaccttaaagaatgtgatcagtgagaagcagcgcacactctatgaa
gctttggaacgccagcagaagtaccaggactccctccagtccatctctacgaagatggag
gccattgagctgaaactcagtgagagcccagagcctggcaggagtccagaaagccagatg
gctgaacatcaggcattgatggatgagattctcatgctccaggatgaaatcaatgagctc
cagtcctctctcgcagaggagctggtatccgagtcttgtgaggccgaccctgcggagcag
ctggccttgcagtccacgctcactgtcttagccgagcgaatgtccaccatcaggatgaaa
gcctcggggaaacggcagcttttggaggagaagttgaatgatcagctggaggaacaaagg
caggaacaggccctgcagaggtatcgctgtgaagccgatgagctggacagctggctcttg
agtaccaaggccactctggacactgcgctgagtccacccaaggagcccatggacatggag
gcccagcttatggactgccagaatatgctggtggaaatagagcagaaggtggtggcttta
tcagaactgtcagtccacaatgagaacctgctgctggagggcaaagctcacaccaaggac
gaggccgagcagctggctggaaagctgagaaggctcaaggggagcctgctggagctgcag
agagccctgcatgataagcagctcaacatgcagggaacagcacaggagaaggaggagagc
gatgttgacctaacagccacgcagagccccggcgtccaggaatggctggcccaagctcgc
accacatggacccagcagcggcagagcagtctccagcaacaaaaagagttagaacaggaa
ttagccgagcagaagagtctccttcgctcagtagccagtcgtggagaggagattctaatt
caacattcggcggcagagacctctggtgatgctggcgaaaaacctgatgtgttatcccag
gagttggggatggaaggggagaaatcatccgctgaagaccagatgagaatgaaatgggaa
agcctacatcaagaatttagtaccaagcagaaactactacagaatgttctggaacaggaa
caagagcaagtgctttatagcaggccaaatcgactcttgtctggtgtgccactgtacaaa
ggggacgtgccaacccaagataaatctgcagttacatctttgctggatggactgaaccaa
gccttcgaggaggtttcatcccagagtggaggggcaaagaggcagagtatacacttggag
cagaagttgtatgatggagtctcagccacctctacttggttggatgacgttgaagaacgt
ttatttgttgccacagcacttttaccagaagaaacagagacttgtctcttcaaccaagag
attcttgccaaagacattaaggaaatgtctgaagaaatggataagaacaaaaacttgttt
tcccaagcttttccagagaatggtgataatcgagatgttattgaagatactttgggttgt
cttttgggcaggttatccttgctagactcagtagtgaatcaacgatgtcatcagatgaaa
gaaagacttcagcaaatactaaatttccagaatgatctgaaagtgctgtttacatcactg
gctgacaacaaatacatcattctgcaaaaactggcaaatgtgtttgaacagcccgtagca
gaacaaatagaggcaatacaacaggctgaagatggactcaaagaatttgatgcaggaatc
attgaattaaagaggcgtggtgacaagctacaggtcgagcagccgtccatgcaagaactc
tccaagctccaggacatgtatgatgagctgatgatgatcattggctcccggaggagtggt
ctgaatcagaaccttacactcaagagtcagtatgagagggccctacaagatctggctgac
ctgctagaaactggtcaggagaagatggcaggagaccagaaaatcatcgtgtcttccaaa
gaggaaatccagcaactacttgacaaacataaggaatactttcagggcctggaatctcat
atgatcttgactgaaacactcttcagaaagataatcagctttgcagtccaaaaggaaacc
cagttccatacagagctgatggctcaggcttctgctgtactgaaacgggctcacaagagg
ggtgtggagctggagtacattctagagacgtggtcccatctggatgaggaccagcaggag
ctcagcagacagctggaggtggtggaaagcagcatcccaagcgtgggtctggtggaggag
aacgaggacaggcttattgaccgcataacactctaccagcatttaaaatctagccttaat
gaataccagcccaaattatatcaagtattagatgatgggaaacgacttctgatatccatc
agctgctcagatctagaaagccaactaaatcaacttggagagtgctggctaagtaacacc
aataaaatgtctaaggaacttcacagactggaaacaatattgaaacactggaccagatat
caaagtgaatctgcagatctaattcactggttacaatctgcaaaagaccggctagaattt
tggactcagcaatctgtgacagtcccacaagagctggaaatggtccgtgatcatctaaat
gctttcctggagttttctaaagaagtggatgcccaatcttccctgaaatcatctgttctg
agtactggaaatcagctccttcgactaaaaaaggtggacacagccacgctgcgctctgag
ctgtcgcgcattgatagccagtggactgacctgctaaccaatatcccagccgtccaggag
aagctccaccagctccagatggataaactgccttcccgccatgccatttctgaagtcatg
agttggatttctctaatggaaaatgttattcagaaggatgaagataatattaaaaattcc
ataggttacaaggcaattcatgaataccttcagaaatataagggttttaagatagacatt
aactgtaaacagctgacagtggattttgtgaaccagtccgtgctacaaatcagcagtcag
gatgtggaaagtaagcgtagtgataagactgattttgctgagcaacttggagcaatgaat
aaaagttggcaaattctgcaaggtctagtaactgagaagatccagctgttggaaggctta
ttggaatcttggtcagaatatgaaaataatgtacaatgtctgaaaacatggtttgaaacc
caggaaaagagactaaaacaacagcatcgaattggagatcaggcttctgttcaaaatgca
ctgaaagactgtcaggatctggaagatttgattaaagcaaaagaaaaagaagtagagaaa
attgagcagaatggacttgctttgattcagaacaagaaagaagacgtctctagcattgtc
atgagcacactgcgagagctcggccaaacctgggcaaatttagatcacatggttggacaa
ttaaagatactgctgaaatcagtgcttgaccaatggagtagtcacaaagtggcctttgac
aagataaacagttacctcatggaggccagatactctctttcccgattccgtctgctgact
ggctccttagaagctgtgcaagttcaggtggacaatcttcagaatctccaagatgatctg
gaaaaacaggaaaggagcttacagaaatttggctctatcaccaaccaattattaaaagag
tgtcacccacccgtgacagaaactcttaccaatacactgaaagaagtcaacatgagatgg
aataacttgctggaagagattgctgagcagctacagtccagcaaggccctacttcagctt
tggcaaagatacaaggactactccaaacagtgtgcttcgacagttcagcagcaggaggat
cgaaccaatgagctgttgaaggcagccacaaacaaggacattgccgatgatgaggttgcc
acatggattcaagattgcaacgacctcctcaaaggactgggcacagttaaagattccctc
ttttttctccatgagctgggagagcaactgaagcaacaagtggatgcttccgcagcatca
gctattcaatcggatcaactctctttgagtcaacacttgtgtgccctggagcaagctctc
tgcaaacagcagacttcattacaggctggagttcttgattatgaaacctttgccaagagt
ttagaagctttggaggcctggatagtggaagctgaagaaatactacaagggcaggaccct
agccactcatctgacctctccacaatccaggaaaggatggaagaacttaagggacagatg
ttaaaattcagcagcatggctccagatttagaccgtctaaatgagcttggatataggtta
cccttgaatgataaggaaatcaaaagaatgcagaatctgaaccgccattggtctctgatc
tcctctcagactacagaaagattcagcaagttgcagtcatttttgctacaacatcagact
ttcttggaaaaatgtgaaacatggatggaattcctagttcagacagaacaaaagttagca
gtagagatttcaggaaattatcagcaccttttggaacagcagagagcacacgagttgttt
caagccgagatgttcagtcgtcagcagattttgcactcaatcattattgatgggcaacgt
cttctagaacaaggtcaagttgatgacagggatgaattcaacctgaaattgacactcctc
agtaatcaatggcagggagtgattcgcagggcccagcagaggcgggggatcattgacagc
cagattcgccagtggcagcgctatagggagatggcagaaaagcttcgtaaatggttggtt
gaagtgtcctacctccccatgagtggtctcggaagtgttcctataccactgcaacaagca
aggaccctctttgatgaagtgcagttcaaagaaaaagtgtttctgcggcaacaaggcagc
tacatcctgactgtggaggctggcaagcaactccttctctcggcggacagtggcgctgag
gccgccttgcaggccgaactcgctgaaatccaagagaaatggaaatcagccagcatgcgg
ctggaagaacagaagaaaaaactagccttcttgttgaaagactgggaaaaatgtgagaaa
ggaatagcagattccctggagaaactacgaactttcaaaaagaagctttcgcagtctctc
ccggatcaccatgaagagctccatgcagaacaaatgcgttgcaaggaattagaaaatgca
gttgggagctggacagatgacttgacccagttgagcctgctgaaggacaccctctctgcc
tatatcagtgctgatgatatctccattcttaatgaacgcgtagagcttctgcaaaggcag
tgggaagaactatgccaccagctctccttaaggcggcagcaaataggtgaaagattgaat
gaatgggcagtcttcagtgaaaagaacaaggaactctgtgagtggttgactcaaatggaa
agcaaagtttctcagaatggagacattctcattgaagaaatgatagagaagctcaagaag
gattatcaagaggaaattgctattgctcaagagaacaaaatacagctccaacaaatggga
gaacgacttgctaaagccagccatgaaagcaaagcatctgagattgaatacaagctggga
aaggtcaacgaccggtggcagcatctcctggacctcattgcagccagggtgaagaagctg
aaggagaccctggtagccgtgcagcagcttgataagaacatgagcagcctgaggacctgg
ctcgctcacatcgagtcagagctggccaagccaatagtctacgattcctgtaactcggaa
gaaatacagagaaagcttaatgagcagcaggagcttcagagagacatagagaagcacagt
acaggtgttgcatctgtcctcaacctgtgtgaagtcctgctgcacgactgtgacgcctgt
gccactgatgccgagtgtgactctatacagcaggctacgagaaacctggaccggcggtgg
agaaacatttgtgctatgtccatggaaaggaggctgaaaatcgaagagacgtggcgattg
tggcagaaatttctggatgactattcacgttttgaagattggctgaagtcttcagaaagg
acagctgcttttcccagctcttctggggtgatctatacagttgccaaggaagaactaaag
aaatttgaggctttccagcgacaggtccacgagtgcctgacgcagctggaactgatcaac
aagcagtaccgccgcctggccagggagaaccgcactgattcagcatgtagcctcaaacag
atggttcacgaaggcaaccagagatgggacaacctgcaaaagcgtgtcacctccatcttg
cgcagactcaagcattttattggccagcgtgaggagtttgagactgcgcgggacagcatt
ctggtctggctcacagagatggatctgcagctcactaatattgaacatttttctgagtgt
gatgttcaagctaaaataaagcaactcaaggccttccagcaggaaatttcactgaaccac
aataagattgagcagataattgcccaaggagaacagctgatagaaaagagtgagcccttg
gatgcagcgatcatcgaggaggaactagatgagctccgacggtactgccaggaggtcttc
gggcgtgtggaaagataccataagaaactgatccgcctgcctctcccagacgatgagcac
gacctctcagacagggagctggagctggaagactctgcagctctgtcggacctgcactgg
cacgaccgctctgcagacagcctgctttctccacagccttcctccaatctctccctctcg
ctcgctcagcccctccggagcgagcggtcaggacgagacaccccggctagtgtggactcc
atccccctggagtgggatcacgactatgacctcagtcgggacctggagtctgcaatgtcc
agagctctgccctctgaggatgaagaaggtcaggatgacaaagatttctacctccgggga
gctgttggcttatcaggggaccacagtgccctagagtcacagatccgacaactgggcaaa
gccctggatgatagccgttttcagatacagcaaaccgaaaatatcattcgcagcaaaact
cccacggggccggagctagacaccagctacaaaggctacatgaaactgctgggcgaatgc
agtagcagtatagactccgtgaagagactggagcacaaactgaaggaggaagaggagagc
cttcctggctttgttaacctgcatagtaccgaaacccaaacggctggtgtgattgaccga
tgggagcttctccaggcccaggcattgagcaaggagttgaggatgaagcagaacctccag
aagtggcagcagtttaactcagacttgaacagcatctgggcctggctgggggacacggag
gaggagttggaacagctccagcgtctggaactcagcactgacatccagaccatcgagctc
cagatcaaaaagctcaaggagctccagaaagctgtggaccaccgcaaagccatcatcctc
tccatcaatctctgcagccctgagttcacccaggctgacagcaaggagagccgggacctg
caggatcgcttgtcgcagatgaatgggcgctgggaccgagtgtgctctctgctggaggag
tggcggggcctgctgcaggatgccctgatgcagtgccagggtttccatgaaatgagccat
ggtttgcttcttatgctggagaacattgacagaaggaaaaatgaaattgtccctattgat
tctaaccttgatgcagagatacttcaggaccatcacaaacagcttatgcaaataaagcat
gagctgttggaatcccaactcagagtagcctctttgcaagacatgtcttgccaactactg
gtgaatgctgaaggaacagactgtttagaagccaaagaaaaagtccatgttattggaaat
cggctcaaacttctcttgaaggaggtcagtcgtcatatcaaggaactggagaagttatta
gacgtgtcaagtagtcagcaggatttgtcttcctggtcttctgctgatgaactggacacc
tcagggtctgtgagtcccacatcaggaaggagcaccccaaacagacagaaaacgccacga
ggcaagtgtagtctctcacagcctggaccctctgtcagcagtccacatagcaggtccaca
aaaggtggctccgattcctccctttctgagccagggccaggtcggtccggccgcggcttc
ctgttcagagtcctccgagcagctcttccccttcagcttctcctgctcctcctcatcggg
cttgcctgccttgtaccaatgtcagaggaagactacagctgtgccctctccaacaacttt
gcccggtcattccaccccatgctcagatacacgaatggccctcctccactctga

DBGET integrated database retrieval system