KEGG   Homo sapiens (human): 2335
Entry
2335              CDS       T01001                                 

Gene name
FN1, CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF, SMDCF
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05100  Bacterial invasion of epithelial cells
hsa05135  Yersinia infection
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
Disease
H01260  Glomerulopathy with fibronectin deposits
H02185  Spondylometaphyseal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    2335 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    2335 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2335 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2335 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2335 (FN1)
   05205 Proteoglycans in cancer
    2335 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    2335 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    2335 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    2335 (FN1)
   05100 Bacterial invasion of epithelial cells
    2335 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    2335 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2335 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2335 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2335 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2335 (FN1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    2335 (FN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   2335 (FN1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   2335 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 2335
NCBI-ProteinID: NP_997647
OMIM: 135600
HGNC: 3778
Ensembl: ENSG00000115414
Vega: OTTHUMG00000133054
Pharos: P02751(Tchem)
UniProt: P02751 Q9UQS6 Q6MZM7
Structure
PDB: 

Position
2q35
AA seq 2477 aa
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgcttaggggtccggggcccgggctgctgctgctggccgtccagtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctaggcaatgcgttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgtaccatcgcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacatgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaagtgttttgatcatgctgctgggacttcctatgtggtcggagaaacg
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctgggagaaggcagc
ggacgcatcacttgcacttctagaaatagatgcaacgatcaggacacaaggacatcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacacctctgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctcctccctatggccactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcacgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacttacggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatactctttc
tgcacagaccacactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttgggttc
tgccccatggctgcccacgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggtcacatgatgaggtgcacgtgtgttggg
aatggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaacgacacattccacaagcgtcatgaagaggggcacatg
ctgaactgtacatgcttcggtcagggtcggggcaggtggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacgttttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgagactccg
agtcagcccaactcccaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggagacctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccaagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacgactcccttttctcct
cttgtggccacttctgaatctgtgaccgaaatcacagccagtagctttgtggtctcctgg
gtctcagcttccgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtacctggatcttccaagcacagccacttctgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcctgatgcccctcctgacacgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcgccatcagtagaaggtagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggtgttcagtataacatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgctcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgaccggctaccgtgtggat
gtgatccccgtcaacctgcctggcgagcacgggcagaggctgcccatcagcaggaacacc
tttgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgcagtg
agccatgggagggagagcaagcctctgactgctcaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaactgattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgaccgtgggccttacccgaagaggacagcccagg
cagtacaatgtgggtccctctgtctccaagtacccactgaggaatctgcagcctgcatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctctattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacgcctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tccggcttgactccaggagtagaatacgtctacaccatccaagtcctgagagatggacag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggaggcaaaccctgacactggagtgctcacagtctcctgggagaggagcaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggaaattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttaaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctacgaacaacatgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggcattgacttttctgatatt
actgccaactcttttactgtgcactggattgctcctcgagccaccatcactggctacagg
atccgccatcatcccgagcacttcagtgggagacctcgagaagatcgggtgccccactct
cggaattccatcaccctcaccaacctcactccaggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccgagggacctggaagttgttgctgcgacccccaccagcctactgatcagctgggat
gctcctgctgtcacagtgagatattacaggatcacttacggagagacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagcggccttaaa
cctggagttgattataccatcactgtgtatgctgtcactggccgtggagacagccccgca
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcccagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagcggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaggtcacacccacaagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctggagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagactgagacgatcactggcttccaagttgatgccgtt
ccagccaatggccagactccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaatgacaat
gctcggagctcccctgtggtcatcgacgcctccactgccattgatgcaccatccaacctg
cgtttcctggccaccacacccaattccttgctggtatcatggcagccgccacgtgccagg
attaccggctacatcatcaagtatgagaagcctgggtctcctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaaccgaatat
acaatttatgtcattgccctgaagaataatcagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcgtcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccagtgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacaccgcccacaacggccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggaaatccaaattggtcacatc
cccagggaagatgtagactatcacctgtacccacacggtccgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcactgatgaagaacccttacagttcagg
gttcctggaacttctaccagtgccactctgacaggcctcaccagaggtgccacctacaac
gtcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactctgtcaacgaaggcttgaaccaacctacggatgactcgtgctttgacccc
tacacagtttcccattatgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccagtgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacatgtcttgggaacggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacataccacgtaggagaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctgggggtgaacccagtcccgaaggcactactggccagtcc
tacaaccagtattctcagagataccatcagagaacaaacactaatgttaattgcccaatt
gagtgcttcatgcctttagatgtacaggctgacagagaagattcccgagagtaa

DBGET integrated database retrieval system