KEGG   Homo sapiens (human): 23354Help
Entry
23354             CDS       T01001                                 

Gene name
HAUS5, KIAA0841, dgt5
Definition
(RefSeq) HAUS augmin like complex subunit 5
  KO
K16588  HAUS augmin-like complex subunit 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23354 (HAUS5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Augmin complex
    23354 (HAUS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAUS5 SLX9 RF-1
Motif
Other DBs
NCBI-GeneID: 23354
NCBI-ProteinID: NP_056117
OMIM: 613432
HGNC: 29130
Ensembl: ENSG00000249115
Vega: OTTHUMG00000048110
Pharos: O94927(Tdark)
UniProt: O94927
Position
19q13.12
AA seq 633 aa AA seqDB search
MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIR
GNLLWYGHQDSPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQ
DTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGL
EPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQQWLSSVETLLTNHPP
GHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQSDSSQTLPSMVHLIQEGWRT
VGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCCLWTELKALHD
QSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGE
VLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSI
HQLHPASPRGSSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMK
TSLPPGLPTQELLQIQASQEKQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPG
QAALSEELCQGLSLPQWRLRWVQAQGALQKLCS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggagctagcgcaggaagcgcgggaactgggttgctgggcggtcgaagagatgggggtg
cccgtggcggcccgggccccggaatcgacgctgcgcaggctgtgtctgggccagggggct
gacatctgggcctacatcttgcagcatgtgcacagtcagaggactgtcaagaagatccgg
ggaaacctactctggtatggccaccaggacagtccacaggtccgtcggaagttagagctg
gaagctgctgtgacccgcctgcgggcagaaatccaggaactcgaccagagcctggagctg
atggagcgagacactgaggctcaggacacggccatggagcaggcacgtcagcacactcaa
gacacccagcgtcgagctctcctcctccgggcccaagctggggccatgcgaagacagcag
catacgctccgagatcccatgcagcggctgcagaatcaactgaggcgcctgcaggacatg
gagaggaaagccaaagtagatgtgacctttggatccctcacgtcggcagctctgggcctg
gagcccgtggtcctgcgtgatgtccgaacagcctgcaccctccgggcccagttcctgcag
aacctcctgcttccccaggccaagaggggcagcctcccaacccctcatgatgaccacttt
ggcacttcgtaccagcagtggctgagctcagtggagacgctgctgacaaaccacccccca
ggccacgtcctggctgccttggagcacctggctgcagagcgggaggcagagattcggtcc
ctgtgcagtggggatgggcttggcgacacagagatatccagaccccaggccccggaccag
tcagactccagccagaccctgccgtccatggttcatctcatccaggagggctggcggact
gtgggtgtgctggtctcccagcggagcaccctcctgaaggagcggcaagtcttgacccag
cgcctccagggcctggtggaggaggtggagagacgcgtcctgggatccagtgagaggcag
gtgctgatactggggcttcggcgctgttgcctgtggacggagctcaaggccctgcacgat
cagagccaggagctgcaggatgcagctgggcatcggcagctcctgctgagggagctacag
gccaaacagcagcggatcctgcactggcgccagctggtggaggagacccaggaacaggtc
cgcctgctcatcaagggaaactcggccagcaagacccgcctgtgccggagcccgggggag
gtgctagctctggtccagcgaaaggtggtccctacatttgaggcagtggcaccacagagc
cgggagctgctgcgctgtctggaggaggaagtccggcatttgccccacattctgttgggc
acgctgctgcggcacaggccgggagagttgaagcccctgcccacggtcctcccatccatc
caccagctgcaccccgcgtccccaaggggctccagcttcatagcgctgagccacaagctg
gggctgcctccagggaaggcctcggagctgctcctgccggcggctgcctctcttcgccag
gaccttctgctcctgcaggaccagcggagcctctggtgctgggatctactccacatgaag
accagcctgccgccaggccttcccacccaggagctgctgcagatccaggcatcccaggaa
aaacagcagaaagagaacctggggcaggctctgaagaggctggagaagctactgaaacag
gcactggagcgaatccctgagctgcaggggatcgtgggggactggtgggagcagccaggc
caggccgccctctctgaggagctctgccagggcctgtccctgccccagtggcggctgcgc
tgggttcaggcccagggggccctgcagaagctgtgcagctga

DBGET integrated database retrieval system