KEGG   Homo sapiens (human): 23357Help
Entry
23357             CDS       T01001                                 

Gene name
ANGEL1, Ccr4e, KIAA0759
Definition
(RefSeq) angel homolog 1
  KO
K18729  protein angel
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23357 (ANGEL1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     23357 (ANGEL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 23357
NCBI-ProteinID: NP_056120
HGNC: 19961
Ensembl: ENSG00000013523
Vega: OTTHUMG00000171494
Pharos: Q9UNK9(Tbio)
UniProt: Q9UNK9 A0A024R6B2
Position
14q24.3
AA seq 670 aa AA seqDB search
MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGL
LQQWREEGLSQVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAA
ENLDEPFPEMLGEEPLLEVEGVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAV
LAWSIAPEPVPQEEASIWPFEGLGQLQPPAVEIPYHEILWREWEDFSTQPDAQGLKAGDG
PQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLMQEFQHWDPDILCLQEVQ
EDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLN
RDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARL
SDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPL
WPSSLGITDCCQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPE
RPAGWAESVLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMT
VDYIFFSAESCENGNRTDHRLYRDGTLKLLGRLSLLSEEILWAANGLPNPFCSSDHLCLL
ASFGMEVTAP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcgtgcttgtgttacctgctgctgccggccacgcgcctcttccgcgccctc
tcagatgctttcttcacatgtcgaaaaaatgtccttctggcgaacagctcatccccccag
gtagagggcgactttgccatggcccctcggggccctgagcaggaggaatgtgagggcctg
ctgcagcagtggcgagaagaagggttgagccaggtgctctcaactgcaagtgaggggccc
cttatagataaaggactagcccagagcagcctggcacttctgatggataatcctggagaa
gagaatgctgcttcagaggacaggtggtccagcaggcagctgagtgaccttcgggctgca
gagaacctggatgagcctttccctgagatgctaggagaggagccactgctggaggtggag
ggggtggagggctccatgtgggcagctatccccatgcagtcggagccccagtatgcagac
tgtgctgccctcccagtgggtgccctggccacagagcagtgggaagaggacccagcggtg
ttggcctggagcatagcacctgagcctgtgccccaggaagaggcttccatctggcccttt
gagggcctggggcagttgcagcctcccgcagtggaaataccatatcatgaaattttgtgg
cgagaatgggaggatttctccacccagccagatgctcagggcctgaaggcaggagatggc
cctcagttccagttcactctgatgtcttataacatcctggctcaggacctgatgcagcag
agctcagagctctatctacattgccatccagacatcctcaattggaactatcgcttcgtg
aacctcatgcaggaattccagcactgggaccctgatatcctgtgtctccaggaagtccag
gaagatcattactgggagcagctggaaccctctctgcgaatgatgggctttacctgtttc
tacaagaggaggactgggtgtaaaaccgatggctgtgctgtctgctacaagcctaccaga
ttccgcctgctctgtgctagccctgtggagtacttccggcctggcttggagctacttaat
cgggataatgtgggcttagtgttgctactgcaaccactcgtcccagaaggcctgggacaa
gtctcggtggccccgctgtgtgtggcaaatacccatatcctttacaacccacgccggggc
gatgtcaagctggcccagatggccattctcctggcggaagtggacaaggtggccagactg
tcagatggcagccactgccccatcatcttgtgcggggacctaaattctgtccctgattca
cctctctacaacttcatcagggatggagagctccagtaccatgggatgccagcctggaag
gtatctggacaggaagacttctcccatcagctttaccagaggaagctgcaggccccactg
tggcccagctccctgggcatcactgattgctgtcagtatgtcacctcctgtcaccccaag
agatcagagagacgcaagtatggccgagacttcctgctacgtttccgcttctgcagcatc
gcttgtcagcgaccagtaggactggtccttatggaaggagtgacagatactaagccagag
cgacctgcgggttgggctgagtctgtccttgaggaagatgcatcggagcttgagcctgcc
ttctccaggactgtaggtaccatccagcactgcctccacctgacgtcagtatatacccac
ttcctgccccagcgtggccgcccagaggtcactacaatgccattgggtcttggaatgaca
gtagattacatcttcttctcagctgagtcctgtgagaatgggaacagaactgatcacagg
ctgtatcgagatggaactctcaagctcctgggtcgtctctcccttctctctgaagagata
ctctgggctgccaatggcttacccaaccccttctgctcttcagaccacctctgcctgcta
gccagcttcgggatggaagtcaccgccccatga

DBGET integrated database retrieval system